KEGG   Bacillus cereus NC7401: BCN_3930Help
Entry
BCN_3930          CDS       T01686                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bnc  Bacillus cereus NC7401
Pathway
bnc00071  Fatty acid degradation
bnc00072  Synthesis and degradation of ketone bodies
bnc00280  Valine, leucine and isoleucine degradation
bnc00310  Lysine degradation
bnc00362  Benzoate degradation
bnc00380  Tryptophan metabolism
bnc00620  Pyruvate metabolism
bnc00630  Glyoxylate and dicarboxylate metabolism
bnc00640  Propanoate metabolism
bnc00650  Butanoate metabolism
bnc00900  Terpenoid backbone biosynthesis
bnc01100  Metabolic pathways
bnc01110  Biosynthesis of secondary metabolites
bnc01120  Microbial metabolism in diverse environments
bnc01130  Biosynthesis of antibiotics
bnc01200  Carbon metabolism
bnc01212  Fatty acid metabolism
bnc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bnc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BCN_3930
   00630 Glyoxylate and dicarboxylate metabolism
    BCN_3930
   00640 Propanoate metabolism
    BCN_3930
   00650 Butanoate metabolism
    BCN_3930
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BCN_3930
   00072 Synthesis and degradation of ketone bodies
    BCN_3930
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BCN_3930
   00310 Lysine degradation
    BCN_3930
   00380 Tryptophan metabolism
    BCN_3930
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BCN_3930
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BCN_3930
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BCN_3930
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bnc04147]
    BCN_3930
Enzymes [BR:bnc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BCN_3930
Exosome [BR:bnc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BCN_3930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: BAL19723
Position
complement(3824484..3825659)
Genome map
AA seq 391 aa AA seqDB search
MHNVVITAAVRSPIGTFGGALKNVTPVELAVPVLQEAVKRGGVEPHEVDEVILGHCIQRT
DEANTARTAALAAGFPDTVTGYTIQRQCSSGMQAIMSAAMQIQLGVSEVVVAGGVEAMSS
SPYALKQHRWGQRLQHGEIRDTVWEVLEDPIHHIMMGETAENLVEQYEITREEQDEVALR
SHTLALKAIESGYFDDQIVPITIKERRKEVVFSKDEHPRADITAEKLAGLKPAFRKDGSV
TAGNASGLNDGSAVLVLMSEEKAKEKGLQPLARIVGYSVAGVDPTIMGIGPAPAIRKGLE
KVDWSLEDADLLEINEAFAAQYLAVEKELGLDREKVNVNGSGVGLGHPIGCTGARITVSL
IHELKRRGLEKGIASLCVGGGIGVALFIEAL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgcataatgttgttattacagcggcagttcgttcgccaattggaacttttgggggagcg
ctaaaaaatgtaacgccagtagaattagctgttcctgtacttcaggaagctgtaaaacga
ggcggggtagaaccacacgaagttgatgaagtgattttaggtcattgtattcaaagaact
gatgaagcaaatacggcaagaacggctgcattagcggcaggatttcctgacacagttaca
ggttatacaatccaacgccaatgttcttcaggtatgcaagcaattatgtcggctgcaatg
caaattcaattaggtgtaagtgaagttgtcgttgcaggtggagtagaagcaatgagttca
agcccttatgcattaaaacaacaccgctggggacaacgcctacaacacggagaaattcgt
gatacggtgtgggaagtattagaagatccaattcatcatattatgatgggggaaacagcg
gaaaatttagttgaacaatatgaaattacaagagaggaacaagatgaagttgcgcttcgt
agtcatacattggcattgaaggcaatcgagtctggatactttgacgatcaaattgttcct
attacaataaaagaacgtagaaaagaagtagtattttcaaaggatgaacatccacgtgct
gacattacagcagaaaaattagcaggattaaaaccagctttccgtaaagacggatctgta
acggcagggaatgcatctggcctgaatgacggaagtgcggttctagtattaatgagcgaa
gaaaaagcgaaagaaaaaggcttacaaccgttagctagaattgttggatattcagtagct
ggagtagatccaacaattatgggtattggaccagcaccagcaattcgtaaagggttagaa
aaagtagattggtcattagaagatgcagatttgctggaaattaacgaagctttcgctgca
caatacttagctgtagagaaagaattaggtttagatcgtgaaaaggtgaatgtaaacggt
agtggtgtaggacttggacatccaatcggttgtacaggagctcgtatcactgtaagctta
attcatgaattgaaaagacgcggattagaaaaaggaattgcctctctatgcgtcggcggc
ggtattggggtagcattatttatagaagcactataa

DBGET integrated database retrieval system