KEGG   Bacillus cereus NC7401: BCN_4371Help
Entry
BCN_4371          CDS       T01686                                 

Definition
(GenBank) glutamate-1-semialdehyde-2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
bnc  Bacillus cereus NC7401
Pathway
bnc00860  Porphyrin and chlorophyll metabolism
bnc01100  Metabolic pathways
bnc01110  Biosynthesis of secondary metabolites
bnc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bnc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BCN_4371
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bnc01007]
    BCN_4371
Enzymes [BR:bnc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     BCN_4371
Amino acid related enzymes [BR:bnc01007]
 Aminotransferase (transaminase)
  Class III
   BCN_4371
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: BAL20164
Position
complement(4213871..4215160)
Genome map
AA seq 429 aa AA seqDB search
MKKFDKSIAAFEEAQDLMPGGVNSPVRAFKSVGMNPLFMERGKGSKVYDIDGNEYIDYVL
SWGPLIHGHANDRVVEALKAVAERGTSFGAPTEIENKLAKLVIERVPSIEIVRMVNSGTE
ATMSALRLARGYTGRNKILKFIGCYHGHGDSLLIKAGSGVATLGLPDSPGVPEGVAKNTI
TVAYNDLESVKYAFEQFGDDIACVIVEPVAGNMGVVPPQPGFLEGLREVTEQNGALLIFD
EVMTGFRVAYNCGQGYYGVTPDLTCLGKVIGGGLPVGAYGGKAEIMRQVAPSGPIYQAGT
LSGNPLAMAAGYETLVQLTPESYVEFERKAEMLEAGLRKAAEKHGIPHHINRAGSMIGIF
FTDEPVINYDAAKSSNLEFFAAYYREMVEQGVFLPPSQFEGLFLSTAHSDADIEATIAAA
EIAMSKLKA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagtttgataagtcgattgcagcgtttgaagaggctcaagatttaatgcctggt
ggcgtaaatagcccagttcgtgcttttaagtctgtcggtatgaatccgttgtttatggag
cgtggaaaaggctctaaagtatatgatatcgatggaaatgaatacatcgattacgtatta
tcatggggtcctttaattcatggtcatgcaaatgatcgtgttgttgaggctttaaaagct
gttgctgaaagaggtacaagcttcggtgccccaacggaaattgaaaataaattagcgaaa
cttgttattgagcgtgtaccatcaattgagattgtacgtatggttaactctggaacagaa
gcaacaatgagtgcactacgtttagctcgtggttatacaggccgtaacaaaattttgaaa
tttatcggttgttatcacggtcatggtgactcgttattaattaaagcgggttctggggta
gcaacgctaggtttaccagatagccctggtgtaccagaaggtgtagcgaaaaatacgatt
acagtagcgtataacgatttagaaagtgtgaaatacgctttcgaacaattcggtgatgat
attgcttgtgtcattgtagaaccagtagcagggaatatgggtgttgttcctccgcaacca
ggatttttagaaggtcttcgtgaagtaacagagcaaaatggtgcattgcttatttttgat
gaagtaatgacaggattccgtgttgcttataattgcggacaaggttattacggtgtaaca
cctgatttaacttgtttaggtaaagtaatcggtggtggattaccggtaggagcatacggt
ggtaaagcagaaattatgcgccaagttgcaccgagcggaccaatttatcaagcgggtact
ttatcaggtaacccactagcaatggcagcaggttatgaaacgttagtacagttaacgcca
gaatcgtatgtagaattcgagcgtaaagctgaaatgttagaagctggtttacgtaaagcg
gctgaaaaacatggcattccgcatcatattaaccgtgcgggttctatgattggtatcttc
tttacagacgaaccagttattaattacgatgcagcaaaatcttcaaacttagaattcttt
gcagcttactatcgtgaaatggtagaacaaggtgtattcttgccaccatctcaattcgaa
ggtttattcttatcgacagcacatagtgatgcagatattgaagcgacgattgcagcggct
gaaattgccatgtcaaaattaaaagcttaa

DBGET integrated database retrieval system