KEGG   Brevundimonas naejangsanensis: DA69_04740Help
Entry
DA69_04740        CDS       T04375                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
bne  Brevundimonas naejangsanensis
Pathway
bne00260  Glycine, serine and threonine metabolism
bne01100  Metabolic pathways
bne01110  Biosynthesis of secondary metabolites
bne01120  Microbial metabolism in diverse environments
bne01130  Biosynthesis of antibiotics
bne01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bne00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DA69_04740
Enzymes [BR:bne01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     DA69_04740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ANF55870
UniProt: A0A172Y9I8
Position
998303..999283
Genome map
AA seq 326 aa AA seqDB search
MAPSALQSLIAANTGFARAYGSDETSARAADLIRQTLDADAEVRFLFSGTAANAIGLSML
ARPYEAVLAHHAAHICTDETGAPGFFGQGVGLIGLPGYSGKVDVAALHAALEEPVVGHRQ
PAAALSLTQATEYGAVYSEEELRHLIEPAKGAGLGVHMDGARLANAVAAGFDPKNIARLG
VDVLSFGGAKAGAHCVEALVIFDKGLTRRIDNRLKQAGQTASKGRLLAAPLLGLLESGDW
LSGAAHANLMAQRLADGIEARTSFVLAHPVESNAVFVRMPDEAHQALNAAGWACYQFDDG
SVRFVCSWATEEAAVDALIDAVASLN
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggcgccttcggcgctccagagcctgattgcggccaataccgggttcgcgcgggcctat
ggctccgatgagacctcggcgcgagccgccgacctgatccgtcagacgctggacgccgac
gccgaggtgcgcttcctgttcagcggtacggcggccaacgccatcggcctgtcgatgctg
gcgcgcccctatgaggcggtgctggcccaccacgccgcccatatctgcaccgatgagacc
ggcgcgcccggcttcttcggtcagggcgtcggcctgatcggtctgcccggctattcgggc
aaggtcgacgtggcggcgctgcacgccgctctggaagagcctgtcgtcggccaccgccag
cctgcggccgccctcagcctgacccaggcgacggagtacggcgccgtctattccgaggaa
gagcttcgtcacctgatcgagccggccaaaggcgcggggcttggcgtccatatggacggg
gcgcggctggccaacgccgtggccgcgggtttcgaccccaagaatatcgcgcggctgggc
gtggatgtcctgtcgttcggcggcgccaaggccggcgcccactgtgtcgaggcgctggtc
atcttcgacaagggcctgacacggcggatcgacaaccggctgaagcaggcgggtcagacg
gcgtccaaagggcggctgctggcggcgccgctgttaggtctgctggaaagcggcgactgg
ttgtcgggcgccgcccacgccaatctgatggcccagcgtctggcggacggcatcgaggcc
cggacgtccttcgttctcgctcatccggtcgagtccaatgcggttttcgtgcgcatgcct
gacgaggcgcatcaggcgctgaacgccgctggttgggcctgctatcagttcgacgacggt
tcggtgcggttcgtctgttcctgggcgaccgaagaggcggcggtggacgccctcatcgac
gctgtggcgagcctgaactga

DBGET integrated database retrieval system