KEGG   Brevundimonas naejangsanensis: DA69_07530Help
Entry
DA69_07530        CDS       T04375                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
bne  Brevundimonas naejangsanensis
Pathway
bne03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bne00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    DA69_07530
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bne03011]
    DA69_07530
Ribosome [BR:bne03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    DA69_07530
  Bacteria
    DA69_07530
  Archaea
    DA69_07530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ANF54605
UniProt: A0A172Y6B7
Position
complement(1593546..1593926)
Genome map
AA seq 126 aa AA seqDB search
MAQTKNPRRVAATEARAKLVNVRISPQKLNLVAQSIRGLPVQKALNELEFSRKRIAGDVR
KVLYSAVSNAENNHNLDIDNLVVAEAFVGKNLVMKRFASRARGRSSRILKPFSEITIVVR
EAGEAA
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atggcccagaccaagaacccccgtcgcgttgctgcgaccgaggcccgcgccaagctggtc
aacgtccgtatcagcccgcagaagctgaacctggtggctcaatcgatccgcggcctgccg
gtgcagaaggctctcaacgagctggaattcagccgcaagcgcatcgccggcgacgtccgc
aaggtcctgtactcggccgtctcgaacgccgagaacaaccacaacctcgacatcgacaac
ctggtcgtcgccgaggccttcgtgggcaagaacctggtgatgaagcgtttcgcgagccgt
gctcgcggccgctcgtcgcgcatcctgaaaccgttcagcgaaatcaccatcgtggttcgc
gaagcaggtgaggccgcctga

DBGET integrated database retrieval system