KEGG   Brevundimonas naejangsanensis: DA69_12740Help
Entry
DA69_12740        CDS       T04375                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
bne  Brevundimonas naejangsanensis
Pathway
bne00471  D-Glutamine and D-glutamate metabolism
bne01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bne00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    DA69_12740
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bne01011]
    DA69_12740
Enzymes [BR:bne01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     DA69_12740
Peptidoglycan biosynthesis and degradation proteins [BR:bne01011]
 Precursor biosynthesis
  Racemase
   DA69_12740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race Stealth_CR4
Motif
Other DBs
NCBI-ProteinID: ANF55528
UniProt: A0A172Y8I8
Position
complement(2650005..2650868)
Genome map
AA seq 287 aa AA seqDB search
MAIGVFDSGVGGLTVHRELTTRFPTRDFIYLGDQAHAPYGGRGGEDIVELTRAGCERLFE
AGASIVVLACNTASAIALRRLQQTWIPGMREKLGRPVNVLGIIVPTIEAATGLPWSYEAE
RNGRLEGEKKQAIDVTGVFCTAATAMSRVYEIEIDKRRDDLAVFTEACPGLAGLIELGAP
PEELKVVIDDHVDALRRRIGRHPDKAVLGCTHYEIVADLFAQALPPGVQIISQPAAVADS
LERYFGRHPEYELGSSARRDFLTTGTPGPQSDLVAQFWGAPLTFEAA
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggcgataggcgttttcgactccggcgtggggggcctgacggtccaccgcgaactcacg
acccgctttccgacgcgggacttcatctatctgggcgatcaggcgcacgccccctatggc
gggcgcggcggcgaggacatcgtcgaactgacccgcgccggatgcgagcgcctgttcgag
gcgggcgcctcgatcgtcgtgctggcctgcaacacggcctcggccattgcgctgcgccgt
ctgcagcagacctggattccggggatgcgcgaaaagctgggccgtccggtcaacgtgctg
ggcatcatcgtgcccaccatcgaggcggccaccggcctgccctggtcctatgaggccgaa
cgcaacgggcggctggaaggcgagaagaagcaggccatcgacgtcaccggcgtcttctgc
accgccgccaccgccatgagccgcgtctatgagatcgagatcgacaagcgccgcgacgac
ctggcggtcttcaccgaggcctgccccggcctggcgggcctgatcgaactgggcgccccg
cccgaggagttgaaggtggtcatcgacgaccacgtcgacgccttgcgccgccggatcggc
cgccatccggacaaggccgtcctgggctgcacccactatgagatcgtggccgacctgttc
gcccaggccctgccgcccggcgtccagatcatcagccagcccgccgccgtcgccgactcg
ctggagcgctatttcgggcgccatccggaatatgagttgggctcctcggcccgccgcgac
ttcctgaccaccggaacgcccggcccgcaatcggacctggtcgcccagttctggggcgcg
cccctgacgttcgaggcggcctaa

DBGET integrated database retrieval system