KEGG   Brevundimonas naejangsanensis: DA69_13500Help
Entry
DA69_13500        CDS       T04375                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bne  Brevundimonas naejangsanensis
Pathway
bne00071  Fatty acid degradation
bne00072  Synthesis and degradation of ketone bodies
bne00280  Valine, leucine and isoleucine degradation
bne00310  Lysine degradation
bne00362  Benzoate degradation
bne00380  Tryptophan metabolism
bne00620  Pyruvate metabolism
bne00630  Glyoxylate and dicarboxylate metabolism
bne00640  Propanoate metabolism
bne00650  Butanoate metabolism
bne00900  Terpenoid backbone biosynthesis
bne01100  Metabolic pathways
bne01110  Biosynthesis of secondary metabolites
bne01120  Microbial metabolism in diverse environments
bne01130  Biosynthesis of antibiotics
bne01200  Carbon metabolism
bne01212  Fatty acid metabolism
bne02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bne00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DA69_13500
   00630 Glyoxylate and dicarboxylate metabolism
    DA69_13500
   00640 Propanoate metabolism
    DA69_13500
   00650 Butanoate metabolism
    DA69_13500
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DA69_13500
   00072 Synthesis and degradation of ketone bodies
    DA69_13500
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DA69_13500
   00310 Lysine degradation
    DA69_13500
   00380 Tryptophan metabolism
    DA69_13500
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DA69_13500
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DA69_13500
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DA69_13500
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bne04147]
    DA69_13500
Enzymes [BR:bne01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     DA69_13500
Exosome [BR:bne04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DA69_13500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ANF55662
UniProt: A0A172Y940
Position
complement(2819086..2820291)
Genome map
AA seq 401 aa AA seqDB search
MADAYIYDAVRTPRGKGKKDGSLHEITALSLASQVLEALRDRNGLDTAKVDDVILGCVSP
VGEQGADIARTAVLAAGWDQETAGFQINRFCASGLEAVNVAAAKVKSGEAGMAVGGGVEA
MSRVPMGSDGGAWPTDPSSAFPTYFVPQGVSADMIATKYGFSRDDVDAYSVESHKRAARS
WAERRFDKSVIAVKNQLGLTQLDRDETIRPNTDMQTLGGLNPSFVMMGGMGFDAVIGQRY
PEVASVNHVHTPGNSSGIVDGAAGVLIGTKEMGEALGLKPRAKILGGASIGSEPSIMLTG
PEPVTRKLLGKLGMQPGDIDLYELNEAFAAVVLRYMQALDIPHDKINVCGGAIAMGHPLG
ATGAMILGTVLDELERSDKSTALATLCIGGGMGTATVIERV
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgcctatatctacgacgccgtgcgcaccccgcgcggcaagggcaagaaggac
ggcagcctgcacgagatcactgcgctgagcctggccagccaggtgctggaggcgctgcgc
gaccgcaacggcctggacaccgccaaggtcgatgacgtgatcctcggctgcgtctcgcct
gtgggcgaacagggcgccgacatcgcgcgcaccgccgttctggccgccggctgggaccag
gagacggcgggcttccagatcaaccgcttctgcgcctcgggcctggaggccgtgaacgtg
gccgccgccaaggtgaagtcgggcgaagcgggcatggccgtcggcggcggcgtggaagcc
atgagccgggtgccgatgggttcggacggcggcgcctggccgaccgacccctcgtcggcc
ttcccgacctatttcgtgccgcagggcgtctcggccgacatgatcgccaccaaatacggc
ttcagccgcgacgacgtggacgcctattcggtcgaaagccacaagcgcgccgcccggtcc
tgggccgagcgccgcttcgacaagtcggtgatcgcggtcaagaaccagctcggcctgacc
cagctggaccgcgacgagaccatccgtccgaacacggacatgcagaccctgggcgggctc
aatccctccttcgtcatgatgggcggcatgggtttcgacgcggtgatcggccagcgctat
cccgaggtcgccagcgtcaaccacgtccacacgcccggcaactcgtccggcatcgtcgac
ggcgcggcgggcgtgctgatcggcaccaaggagatgggcgaggcgctgggcctgaagccg
cgcgcgaaaatcctgggcggcgcctccatcggctcggagccgtcgatcatgctgaccggc
cccgagcccgtcacccgcaagctgctgggcaagctgggcatgcagccgggcgacatcgac
ctgtacgaattgaacgaggccttcgcggccgtggtgctgcgctacatgcaggcgctcgac
atcccgcatgacaagatcaacgtctgcggcggcgccatcgccatgggccacccgctgggc
gccaccggcgccatgatcctgggcacggtgctggacgagctggaacgctcggacaagtcg
acggccctggccaccctgtgcatcggcggcggcatgggcaccgccaccgtcatcgaacgc
gtctga

DBGET integrated database retrieval system