KEGG   Brenneria nigrifluens: EH206_02570Help
Entry
EH206_02570       CDS       T06070                                 

Gene name
psd
Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
bng  Brenneria nigrifluens
Pathway
bng00564  Glycerophospholipid metabolism
bng01100  Metabolic pathways
bng01110  Biosynthesis of secondary metabolites
Module
bng_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:bng00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    EH206_02570 (psd)
Enzymes [BR:bng01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     EH206_02570 (psd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: QCR03195
Position
complement(547506..548465)
Genome map
AA seq 319 aa AA seqDB search
MLDRIKIKLQYWLPKIWLTRLAGWGADKPAGKLTKLAIDLFVRYYKVNMQEAQQPDTAAY
RTFNEFFVRPLRPDVRPVDAHAQRLVQPADGVLSQLGAIADGKLIQAKNHHYSLEALLAG
NYVMADLFRDGLFATTYLSPRDYHRVHMPCDGVLREMIYVPGDLFSVNLLTAQNVPNLFA
RNERLICLFDTEFGPLAQILVGATIVGSIETVWAGVATPPREGIIKRRTYPQAGEEGAVA
LAKGQEMGRFKLGSTVINLFSSSRIQFSAHLGCLSVTRVGEPFAQVRDNERTDDAIEETS
APLASPDADTNAGATDHPG
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
gtgctggatcgcatcaaaatcaaattacagtattggctacccaaaatctggctgacccgt
ttggccggctggggagcggataaaccggcgggcaaactcaccaagctggcgatcgatctg
ttcgtccgctactacaaggtcaatatgcaggaagcgcagcagccggataccgccgcttac
cgcaccttcaacgagttttttgtccgtccgctgcgccccgacgtccgcccggtggacgct
cacgcgcagcggctggtacagccggccgacggcgtgctgtcccagctgggcgccatcgcc
gacggcaagctgattcaggccaaaaatcaccattattcgctggaagcgctgctggcgggc
aactacgtcatggccgacctgttccgcgacggcctgttcgccaccacctatttatcgccg
cgcgactatcaccgcgtccatatgccgtgcgacggcgtgctgcgggaaatgatttatgtg
ccgggggatctgttctccgtcaatctgctgacggcgcaaaacgtgcccaatctgtttgcc
cgcaacgagcgccttatctgcctgttcgacaccgaattcggcccgttggcgcagattctg
gtcggcgccaccatcgtcggcagtattgaaaccgtctgggcgggcgtggcgacgccgccg
cgagaaggcatcatcaaacgccggacctacccgcaggcgggcgaggaaggcgcggtcgca
ctggcgaaaggccaggaaatggggcgctttaagctgggctctacggtgatcaacctgttc
tcatccagccggattcagttttccgcccacctcggttgcctgagcgtcacccgcgtgggt
gaacctttcgcgcaagtgcgggataatgaacggacggacgacgccatagaagagacgtcc
gcgccgcttgcatcccctgatgcggatactaacgccggcgccacggaccatccgggttga

DBGET integrated database retrieval system