KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_00015Help
Entry
BANAN_00015       CDS       T02047                                 

Definition
(GenBank) recombination protein RecF
  KO
K03629  DNA replication and repair protein RecF
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
Pathway
bni03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bni00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    BANAN_00015
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bni03400]
    BANAN_00015
DNA repair and recombination proteins [BR:bni03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     BANAN_00015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SMC_N AAA_23 AAA_21 AAA_15 SbcCD_C AAA_27 DUF2326 AAA_29
Motif
Other DBs
NCBI-ProteinID: AFI62232
Position
3661..5088
Genome map
AA seq 475 aa AA seqDB search
MITVSRLALDHFRSWTNCVLDFKPGVNILEGPNGLGKTNIVEALEVLSTGFSHRASTSQP
LVERGFPAATIRANIEELSEDFENNTETIDGWTTTFELTIRVRGANRARVDGGPSLYMRD
IVGRVPLIAFTPDDQRLVWGDPAVRRSFIDQAASVLVRGYTDLLQRFTHIAKQRAALLKQ
IGAQEGVPVSEEARQMRMNGLEVWTAQFIETGLELTRQRMAVIGMLNEYFGTIVQELSDV
GQTATLVYEPSFDELYLTQGAEAGEQGGLGRVKAAISEHFQRIYPGEVARGMNLIGPQRD
DVSIELNGMPAREYSSNGESWTLALALKMALYRLLERKSGERPIVVLDDVFAQLDPSRRA
KIMEFALRQDQVIITVAAAGDVPELPDDAHAHVIDVAALKLQGSGGEGTALMPEPLPADD
PFAGQLAAVQASRRTAGTHTGSDGKQKVEQSADQSAEQVSGEREIGLTKHESAHA
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccgtatctcggctggcgcttgaccacttccgttcctggacgaattgcgtgctg
gatttcaaaccgggcgtcaacattctggaaggcccgaacggactcggcaaaacgaacatc
gtcgaggcgctcgaggtgctgtccaccggcttcagccatcgcgcctcaacatctcagcca
ctcgtcgaacgagggttccccgcagccaccattcgcgcgaatatagaggaactatcggaa
gatttcgaaaacaacactgagacaatagatggctggacaaccaccttcgagctgacgatt
cgggtgcggggagccaaccgcgcccgtgtggacggcggtccgagcctgtatatgcgagac
attgtggggcgtgtgcccctcatcgcattcactcccgatgaccagcgtctagtgtggggc
gacccagccgtgcgccgttcgttcatcgatcaggccgccagtgtgctggttcgcggctat
actgacctgttgcaacgcttcacgcatatcgccaagcaacgcgcggcgctgctcaagcag
atcggtgcgcaggagggcgtcccggtgtccgaggaggcgcgccagatgcgcatgaacggc
ttggaggtgtggaccgcgcagttcattgaaaccggtctggaactcacccgacagcgcatg
gcagtcatcggcatgctcaacgaatatttcggaacaatagtccaggaattaagtgatgtc
ggtcaaacggcgacgcttgtgtatgagccgtcgttcgacgagctatacctcacccaaggg
gccgaggcaggggaacaaggcggtctcgggcgggtgaaggcggcgatcagcgagcatttc
cagcgcatctacccgggggaggtggcgcgtggaatgaatctgatcggcccccagcgtgac
gacgtctcgattgaactcaacggcatgccggcacgcgaatactcgtcgaacggagaaagc
tggacgctggcgctggccttgaaaatggccctctaccgtctcctggaacgcaagtcgggg
gagcggcccatcgtggtgctcgacgatgtgttcgcgcagctggacccgtcacgtcgcgca
aaaatcatggaattcgcgttgcggcaggaccaggtgatcatcaccgttgcggcggccggc
gacgtgccggaactgcctgacgacgcccatgcccatgtgatcgatgtggcggcgttgaag
ctgcaggggagtggcggcgaaggcaccgctctcatgccggagccactgccggccgacgac
cccttcgccggtcagctggccgccgtgcaagcctcccggcgaaccgcgggcacgcataca
ggcagtgatggcaaacagaaggtcgaacaatctgcagaccaatcggcagaacaggtttcg
ggtgagcgtgaaattggtctgacgaagcatgaaagtgcacatgcatga

DBGET integrated database retrieval system