KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_00025Help
Entry
BANAN_00025       CDS       T02047                                 

Gene name
gyrB
Definition
(GenBank) DNA gyrase subunit B
  KO
K02470  DNA gyrase subunit B [EC:5.99.1.3]
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
Brite
KEGG Orthology (KO) [BR:bni00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bni03032]
    BANAN_00025 (gyrB)
   03400 DNA repair and recombination proteins [BR:bni03400]
    BANAN_00025 (gyrB)
Enzymes [BR:bni01000]
 5. Isomerases
  5.99  Other isomerases
   5.99.1  Sole sub-subclass for isomerases that do not belong in the other subclasses
    5.99.1.3  DNA topoisomerase (ATP-hydrolysing)
     BANAN_00025 (gyrB)
DNA replication proteins [BR:bni03032]
 Prokaryotic Type
  DNA Topoisomerases
   BANAN_00025 (gyrB)
DNA repair and recombination proteins [BR:bni03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHIIR (short-homology-independent illegitimate recombination)
     Facilitator
      BANAN_00025 (gyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_gyraseB DNA_gyraseB_C HATPase_c Toprim HATPase_c_3
Motif
Other DBs
NCBI-ProteinID: AFI62234
Position
5779..7896
Genome map
AA seq 705 aa AA seqDB search
MADQPTDSAAESLESASNDPIDQNLEANGTDQNDEQLDDTLSPEHYDASDLRVLEGLEAV
RIRPGMYIGSTGPRGLHHLVYEIVDNSVDEALAGYATHIEVTILPDNGIRVVDDGRGIPV
DEVPGEGKSGVETVMTKLHAGGKFGGGGYAVSGGLHGVGISVVNALSTRVDVEVRRQGYY
WTQTYIDQHPTGPLERGRAMRDDESTGTSVTFWADPKIFETTIYDFETLRSRFQQMAFLN
KGLKITLTDMRQVDEARDEVVGDGDNTVEELHQTVTYQYKNGIKDYVAFLVKSRGSAPIE
PDVIDIESEDLAIGVSAEIAMQWTSAYSESVHTFANTIATTEGGTHEEGFRAALTSMINR
YARDKNILKDKDDNLSGDDVREGLTAVISVKLTNPQFEGQTKTKLGNSEAKTFVQRVMNE
KLGDWLDAHPNEAKNIIQKALEASRARLAAKKARENTRRKSIFESAGMPDKLKDCQSNDP
SECELFIVEGDSAGGSAIQGRNPLTQAILPLRGKILNTERASLDRMLKSDTIESLITAIG
GGYGEDFDLDKVRYHKVIIMADADVDGAHIATLNLTLFFRYMRPMITAGYVYVAMPPLYR
LKWTKGPHDFVYTDAERDRVLAEGKANGRQLPKGEGIQRYKGLGEMSYQELWETTMDPDH
RILKQVHIEDALQADETFSMLMGDEVEPRRLFIQRNAHNARWIDA
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
gtggcagatcaaccaaccgattccgcagcggagtcgcttgagtcggcgagcaacgatccg
atcgatcagaaccttgaagccaacggcacggaccagaacgacgaacagttggacgacacc
ctgtctcccgagcattatgacgcgagcgacctgcgtgtgctcgaagggcttgaggccgtg
cgcattcgccctggcatgtacatcggttccaccggtccgcgaggcctgcaccacttggtc
tatgagatcgtcgacaactcggtcgacgaggcgctggccgggtatgccacgcacatcgag
gtgacgatcctgcccgacaacggcattcgcgtggtcgacgacggccgaggcattccggtc
gacgaagtgcccggcgaaggcaagtccggcgtcgagaccgtcatgacgaagctgcacgcc
ggcggcaagttcggaggcggcggttatgcggtgtccggcggtctgcacggcgtgggcatc
tcggtggtgaacgcgctctccacgcgcgtggacgtcgaagtgcgtcgacagggctactac
tggacgcagacgtacatcgaccagcatcccaccgggccgctcgagcgcggacgtgcgatg
cgcgacgacgagtccaccggcacgtcggtcacgttctgggcagacccgaagatcttcgag
acgacaatctacgatttcgagaccctgcgcagcagattccagcagatggcgttcctgaac
aagggactcaagatcacgctcaccgacatgcgccaggtcgacgaggcgcgcgacgaagtg
gtcggcgacggcgacaacacggtggaggagctgcaccagaccgtcacgtaccaatacaag
aacggcatcaaggactacgtggcgttcctggtgaagtcgcgtggttccgcgccgatcgag
ccggacgtgatcgacattgagtccgaggacctcgccataggcgtctccgcggagatcgcc
atgcagtggacgtcggcgtactcggaatccgtacacaccttcgcgaacacgatcgccacc
accgagggcggcacccatgaggagggcttccgcgcggcgctcacgagcatgatcaaccgg
tatgcccgcgacaagaacatcctcaaagacaaagacgacaatctctccggtgacgatgtg
cgtgaaggcctgaccgcggtgatctcggtgaagctgacgaacccgcagttcgaaggccag
acgaagacgaagctcggcaactccgaggcgaagaccttcgtgcagcgcgtgatgaacgag
aaactcggcgactggctcgacgcccacccgaacgaggcgaagaacatcatccagaaggcg
ctcgaggcatcgcgcgcccgcttggccgcgaagaaggcacgcgagaacacccgccgcaag
tcgatcttcgaatccgccggcatgcccgacaagctcaaggactgccagtcgaacgacccg
agcgagtgcgagctgttcattgtcgagggcgactcggcaggcggctcggccattcagggt
cgcaacccgctgacgcaggcgattctgccgctgagaggcaagatcctcaacaccgagcgc
gccagcctcgaccgcatgctgaagtccgacacgatcgagtcgctgatcacggcgatcggc
ggcggttacggcgaggacttcgacctcgacaaggtgcggtaccacaaggtgatcatcatg
gccgatgcagacgtcgacggcgcccatatcgccacgctcaacctcacgctgttcttccgc
tacatgcgccccatgatcacggccggctacgtgtatgtggctatgccgccgctctaccgt
ctcaagtggacgaagggcccgcacgacttcgtgtacacggacgccgaacgcgaccgcgtg
cttgccgaaggcaaggcgaacggacgccagctgccgaagggcgagggcattcagcgctac
aagggtctgggcgagatgagctaccaggagctgtgggagaccaccatggatccggaccac
cgcattctgaagcaggtgcatatcgaagacgccctgcaggccgacgaaacgttctccatg
ctcatgggcgacgaggtggagccccgccgtctgttcatccagcgcaacgcacacaacgcc
cgctggatcgacgcctga

DBGET integrated database retrieval system