KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_00040Help
Entry
BANAN_00040       CDS       T02047                                 

Definition
(GenBank) hypothetical protein
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VanZ RDD
Motif
Other DBs
NCBI-ProteinID: AFI62237
Position
11600..12673
Genome map
AA seq 357 aa AA seqDB search
MLWPFVSLLLTLPIVAFVYHRNHRLSFTSAFSAYVAVLYALGLVAFTMYPMPDDPTLFCA
THNLAPQLDILRFIQDAQTGLYGVLQLVMNVVLFMPLGFMLCRWAGWKFWVTSAFALGCS
IFIETSQLTGIWGIYPCAYRQFDVDDMLTNTLGAMLGYACAVLYTKLVPKKAKQLTGTNM
RPGFVHRMVSMCIDFLLIALVYMPLSILYIFLFYLVFKSTGDGHYVWLSLTVEPRVLDYM
TWITAALSFLLFEVWIPWRHHGQTLGCRYTHMTIETRDRLRGQRIVFYAIRTLFFGVIFG
GLATNHPIWGWTLLALLIFWLVKKCMPWDLVPGTDPQMPPTSPQPQVFTLPEPNLQR
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgctgtggccgttcgtgtcgttgctgctcacattgccgattgtggcgttcgtctaccac
cgcaaccaccggctgagcttcaccagcgcgttctccgcatatgtggcggtgctgtatgca
ctcggcctcgtggccttcaccatgtacccgatgcccgacgaccccacactcttctgcgcc
acgcacaacctcgccccgcagctcgacattctgcggttcattcaggatgcgcagaccggc
ctgtacggcgtgctgcaactcgtgatgaacgtcgtgttgttcatgcccctcggcttcatg
ctgtgccgttgggctggctggaaattctgggttacctccgccttcgcactcggctgctcc
atattcatcgaaacctcgcagctcaccggaatctggggcatctacccgtgcgcgtaccgc
cagttcgacgtcgacgacatgctcacgaacacgctcggcgcaatgcttgggtatgcatgc
gccgtgctctacacgaaactcgtgccgaagaaggcgaagcaactcaccggcacgaacatg
cgaccgggattcgtgcaccgcatggtctccatgtgcatcgacttcctgctcatcgcgctg
gtgtacatgccactgagcatcctgtacatcttcctgttctacctggtgttcaaatcgacc
ggagacggccattacgtctggctgtcgctcaccgtggaaccgcgcgtgctcgactacatg
acgtggatcaccgcggccctctcgttcctgctgttcgaggtgtggattccctggcgtcac
catggccagacgctcggctgccgctacacccatatgaccatcgagacacgtgatcgcttg
cgcggccagcgcattgtgttctacgcgatccgcacgctgttcttcggcgtcatattcggc
ggtctcgccacgaaccacccgatctggggatggacgttgctcgcgctgctcatcttctgg
cttgtcaagaagtgcatgccgtgggatctcgtgccggggaccgatccacagatgccacct
acttcgccacagccgcaggttttcacgctgccggaaccgaatctgcagcgatga

DBGET integrated database retrieval system