KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_00045Help
Entry
BANAN_00045       CDS       T02047                                 

Definition
(GenBank) Putative hemolysin III-like membrane protein
  KO
K11068  hemolysin III
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
Brite
KEGG Orthology (KO) [BR:bni00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:bni02042]
    BANAN_00045
Bacterial toxins [BR:bni02042]
 Type II toxins: Membrane damaging toxins
  Pore-forming toxins, Other
   BANAN_00045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HlyIII PetG
Motif
Other DBs
NCBI-ProteinID: AFI62238
Position
complement(12754..13548)
Genome map
AA seq 264 aa AA seqDB search
MKRNNRHVSQVTRSQKPRKVVTAKKLSAQNKRNEQYRTKLQLKQILLEKPKLRGWLHLIA
FPFSVATSVILICLAPHGWMKVAISIYSATIILLFGNSAALHLGHGHFPKAVDDVLCRID
YSNIFLVIAGTCTPFFFALNNTVICWVYVGVVWVTALLGTFVHLIYPVGLDWLFTIVYIV
LGLAPITIIWLFWRSPYIGPIPTILVIAGGAFYIAGAVCFAMRKPNPFPKWFGYHELFHL
GTIGGYVCHMIALFMVVMRMRALM
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcaacaaccggcacgtcagtcaggtcacgcgttcccagaaaccgcgcaaagtg
gtgacggcgaagaaactcagcgcacagaacaagcgcaacgagcagtaccgaaccaaattg
cagctcaagcagatcctgctggaaaaaccgaaactgcgcggatggctgcatctcatcgcc
ttcccgttctcagtggccacttcggtgatcctcatctgcctggcaccgcatggctggatg
aaggtggcgatcagcatctacagcgccacgatcatactgctgttcggcaacagcgcggcg
ctccatctcgggcacgggcacttcccgaaagccgtcgacgacgtgctgtgccgcatcgac
tattcgaacatattcctggtgatcgcgggcacctgcacaccgttcttcttcgcactgaac
aacacggtgatctgctgggtgtatgtgggcgtggtctgggtcaccgcattgcttggcacg
ttcgtgcacctgatctaccccgtcggcctcgactggctgttcaccattgtctacattgtg
ctcggactcgccccgatcacgatcatctggctgttctggcgctccccgtacatcggaccg
attcccaccattctcgtgatcgccgggggtgccttctacatcgcgggtgctgtgtgcttc
gccatgcgcaagccgaacccgttcccgaaatggttcggataccatgagctgttccatttg
ggtaccattggcggctatgtgtgccatatgatcgcactgttcatggtggtgatgcgcatg
cgtgcgctcatgtaa

DBGET integrated database retrieval system