KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_00080Help
Entry
BANAN_00080       CDS       T02047                                 

Definition
(GenBank) hypothetical protein
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CP_ATPgrasp_1 CP_ATPgrasp_2
Motif
Other DBs
NCBI-ProteinID: AFI62243
Position
19033..19329
Genome map
AA seq 98 aa AA seqDB search
MKRATVAMICGLLCGSFRKICRGEDNLRIPSGASSPLFACDIERRTTPRLFRDVRVRYKT
VFFLIMVGLLCGDAVIDHTAENYGRLLTQMYGNRPYLP
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacgggccacagtggcgatgatctgcggactgttatgcggaagcttccgtaaaatc
tgccgtggcgaagacaacctgcgcattccatccggcgcgagctccccgctgttcgcatgc
gacatcgaacgccgcaccacgccccgtctgttccgcgatgtgcgcgtgcgttacaagacc
gtctttttcttgattatggtcggtttgttatgcggggatgcggtaatcgaccatactgcg
gagaactatggtcgtttgctgacgcagatgtatggtaatcgaccatacttgccgtga

DBGET integrated database retrieval system