KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_00115Help
Entry
BANAN_00115       CDS       T02047                                 

Definition
(GenBank) oxidoreductase
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FMN_red Flavodoxin_2 Raptor_N
Motif
Other DBs
NCBI-ProteinID: AFI62250
Position
27019..27618
Genome map
AA seq 199 aa AA seqDB search
MAQLTNEERIEVNDGREMKVLMIVGSLRKNSFNKQLAAMAEQELGDRASVSVLDWSEVPV
FNQDEEFPTPKSVAEARVAVNEADAIWIFTPEYNHSVPGSLKNLFDWLSRPLEDGTPSVL
TGKVMTMSGVGGLNTLRYAFAAWMPSLTLFKMRIVPVPFTGVTLNREMFSTDKLELNAAM
RTSLKYQADATLQAIAEAE
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggcacagctcaccaatgaggaacgtatcgaagtgaacgacggtcgcgaaatgaaagtg
ctgatgatcgtcggatcgctgcgcaagaactcgttcaacaagcagcttgcggcaatggcg
gagcaggagctcggcgaccgcgcgtcggtgagcgtgcttgattggagcgaggtgccggtg
ttcaatcaggacgaggaattccccacgcccaagtcggtcgccgaggcgcgcgttgcggtg
aacgaggcggatgcgatctggattttcacgcccgagtacaaccatagtgtgccggggtcg
ctgaagaatctgttcgactggctgtcgcgaccgctcgaagatggcacgccgtcagtgctc
accggcaaagtgatgacgatgagcggcgtgggcggtctgaacacgctgcggtacgcgttc
gcggcgtggatgccctcgctcaccctgttcaaaatgcgcattgtgccggtgccgttcacg
ggcgtcacactcaaccgcgagatgttcagcaccgataagctcgaactgaacgcggcgatg
cgcacgtcgctaaaataccaggccgacgccacgttgcaggcgattgccgaggccgagtag

DBGET integrated database retrieval system