KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_00130Help
Entry
BANAN_00130       CDS       T02047                                 

Definition
(GenBank) hypothetical protein
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_17 UPF0175 ANT HTH_Tnp_ISL3 MerR DUF3853 Phage_Cox HTH_23 HNH_2
Motif
Other DBs
NCBI-ProteinID: AFI62253
Position
complement(29235..29669)
Genome map
AA seq 144 aa AA seqDB search
MTIEAIPISHVQSGTAYLTVGDGKAYVLDESTLELVMQALTENTPETAIPHDDSTEADDL
LTTGEAAHILGVSSKTVGRILDAGEIPYVRYTERGNRWVSRANVLAYRENAHKRHRDHLR
NMQEIASEGNLDAVDYATYLTQFE
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcgaagcgattcccatctcgcatgtgcaaagcggcacggcctaccttaccgtc
ggcgatgggaaggcgtatgtgctcgacgaatcaacactggaactggtgatgcaagcattg
acggaaaatactccggaaacggcgattccccacgacgattccaccgaagccgacgatctt
ctcaccaccggcgaggccgcgcatattctcggcgtatcttcaaaaacggtggggcgcatt
ctggacgccggagagattccctacgtgcgctacacagaaagagggaaccgttgggtaagc
cgcgcgaatgtgctcgcttaccgggaaaatgcacataaacgccatcgtgatcatctcaga
aacatgcaagagattgcttcggaaggcaatctcgacgctgtcgactacgccacatatctc
actcagtttgaataa

DBGET integrated database retrieval system