KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_00135Help
Entry
BANAN_00135       CDS       T02047                                 

Definition
(GenBank) hypothetical protein
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4234 UPF0715 MgtC
Motif
Other DBs
NCBI-ProteinID: AFI62254
Position
complement(30053..30427)
Genome map
AA seq 124 aa AA seqDB search
MAKFILLGIITFSIYPIVIMTTTAEDLNIIASRYNGKKTMNYCLMFFLISWLTLGIGWLV
WHNNFSARIGDEQRRRGLAPTVTAATYWLWAVLGSLIVVGPFIYYYKVLNAMNELCAAYN
ATGC
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
ttggccaagttcattctgctgggcatcattacgttcagcatctaccccatcgttatcatg
accaccacggccgaggacctcaacatcatcgccagccgctacaacggcaaaaagacgatg
aattactgcctcatgttcttcctgatcagttggctcacactgggcatcggctggctcgtg
tggcataacaatttcagcgcgcgcatcggcgacgagcaacgtcggcgcggactggcaccc
accgtcaccgccgccacctattggctgtgggcagtactgggctcactcatcgtggtggga
cctttcatctactactacaaggtgctcaatgcgatgaacgagctgtgcgccgcatacaac
gcaaccggctgctag

DBGET integrated database retrieval system