KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_00155Help
Entry
BANAN_00155       CDS       T02047                                 

Definition
(GenBank) transposase for IS3509a
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transposase_mut MULE DDE_Tnp_IS66
Motif
Other DBs
NCBI-ProteinID: AFI62258
Position
complement(32338..32976)
Genome map
AA seq 212 aa AA seqDB search
MKKNGHDRLGSQRWMCTDCNATRGVRHYRRRDRGELSAFLAWPFGPAAQPGPSRTFRRRT
AGCWRIHPRLEPDGVVRHVLMADGTYLRHGRCLLTAIDGASGAVVAFRWCRHENTADYLA
LFEKIPAPNVLVCDGMRGIETAARSAWPSTRIQRCLVHVRRDCVNDLTHRPRLQAGRELK
RLADALVTIREPDHAAHRSALPHDAIGFAGVD
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagaacggacatgaccgattgggctcgcagcggtggatgtgcaccgactgcaac
gccacacgaggggtgcgccattaccggcgtcgggaccgcggcgagctcagcgcgttcctc
gcatggccgttcggcccggcggcccagcccggcccctcgcgcacgttccgccgaaggacc
gccggctgctggcgcatacaccccaggctggagcccgacggcgtggtgcggcatgtgctc
atggccgacggcacctacctgcgccacggccgttgcctgctgaccgccatcgacggcgcc
agcggggcggtggtcgcgttccggtggtgccgccatgagaacaccgccgactacctggca
ttgttcgagaagatccccgcgcccaacgtgctggtatgcgacgggatgcgcggcatcgaa
acggccgcccgcagcgcgtggccgtccacccgcatccaacgatgcctggtgcacgtgcgc
cgcgactgcgtcaacgacctgacgcaccggccacgcctgcaggccggacgcgagctcaag
aggctagccgacgcgctcgtgacgatccgggagcccgaccatgccgcccaccggtctgcc
ctcccgcatgatgcgataggcttcgccggcgtcgattga

DBGET integrated database retrieval system