KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_00210Help
Entry
BANAN_00210       CDS       T02047                                 

Definition
(GenBank) hypothetical protein
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AFI62269
Position
44950..45255
Genome map
AA seq 101 aa AA seqDB search
MGYHAVGRCGMGIQEALRKAAEMQSHLEIVSVVEYGPYWIFSYCEPGLTPEECPGMLMLK
MRRTDGFSTYLHVQDKDFLDIVKHATKVDLPEHTLPYSPTS
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atgggttaccatgctgtggggcggtgtggtatgggcattcaggaagcattgcgcaaggcg
gccgagatgcaatcgcatctcgagatcgtctctgtggtggagtatggaccatactggatt
ttcagctactgtgaaccaggtctaactccagaagagtgtcctggtatgcttatgttgaaa
atgcggcgaacagatggtttcagcacctatctgcatgtgcaggacaaagacttcctggac
attgtgaagcacgcgacaaaagtagatctgcccgagcatacactcccatattcgcctact
tcctag

DBGET integrated database retrieval system