KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_00215Help
Entry
BANAN_00215       CDS       T02047                                 

Definition
(GenBank) MazG nucleotide pyrophosphohydrolase domain protein
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MazG-like MazG dUTPase_2 PRA-PH
Motif
Other DBs
NCBI-ProteinID: AFI62270
Position
complement(45852..46175)
Genome map
AA seq 107 aa AA seqDB search
MISDDTLRMIHQFSADRNWQQFHAPANMAKSVSIEAGELLECFQWSDEPRDGDWEHVYEE
LADVMIYCIQMADVLGVDLDEIIRDKMAKNAKKYPVEASHGSSAKAE
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atgatctccgatgacacgctccgcatgatccaccagttcagcgcagaccgcaactggcag
caattccacgcgcctgccaacatggcgaaatcggtgagcatagaagcgggcgagctgctc
gagtgcttccagtggagcgacgagccgcgcgacggcgactgggaacacgtgtacgaggag
ctcgccgacgtgatgatctactgcatccagatggccgacgtgctcggcgtcgacctcgac
gagatcatccgcgacaaaatggcgaaaaacgccaagaaatacccggtggaagcaagccac
ggctccagcgcgaaagcggagtga

DBGET integrated database retrieval system