KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_01185Help
Entry
BANAN_01185       CDS       T02047                                 

Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
Pathway
bni00670  One carbon pool by folate
bni01100  Metabolic pathways
bni01120  Microbial metabolism in diverse environments
bni01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bni00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    BANAN_01185
Enzymes [BR:bni01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     BANAN_01185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA DUF1611 TyrRSs_C
Motif
Other DBs
NCBI-ProteinID: AFI62462
Position
281839..283356
Genome map
AA seq 505 aa AA seqDB search
MTLIENFTKPYGLVDKIDAFGYLDSLKNNPDAPRKQGKVVLVTADTPLKASRGEGKTTTT
IALIDALNERGIDAAAVLRQPSMGITAAGSKGGASGGGKASLTHPELIDWGLCGEMGSIE
AAQNLLVSFAEKAIDDGLLDTVLVPRVSEVPSRSLRQIAVDRGKGNVPERVVLTPTCELM
QIVVLSRSMDEIADRVAHMIAGTKDGKPVIFGEFIDLWRITNMLTDAVKPAKTETVNGSP
VYVHGGPFANVSIGIPTLVSVEMACALHDVVIVEAGYGADAGAQKWLDIACREYGAQWPS
AAVVVTRATTWRDDPALQWRYPFHVDRLEKLGIPTFPLINLWEGEDDQIPALRETAEELG
FRDPIVGNLFRDGGEALAPQLDAFVEAVSDEALPEQPKSFKGESLREKIEFVCGNAYGVP
ADRVVDKAGFAESEAEAERLCADAGIDFADLALVAVKSPATMTDNDAAPADERTVTLKKV
EAHSGAGLVQVNLTTSLTTPMPKIV
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
gtgacgctcatcgagaacttcaccaagccttacggattggtagacaagatcgacgctttc
ggttacctcgactccctgaagaacaaccccgacgcaccgcgtaagcagggcaaggtggtg
cttgtgacggcggacaccccgctcaaggcatcgcgcggcgagggcaagaccaccacgaca
atcgcgctcatcgacgcgctcaacgaacgtggcatcgatgcggccgccgttcttcgccag
ccgagcatgggcatcaccgcagccggttcgaagggcggtgcctccggcggcggcaaggcg
tcgctcacgcatcccgagctcatcgactggggtctgtgcggcgagatggggtcgatcgag
gccgcgcagaatctgctcgtctccttcgccgagaaggctattgacgacggcctgctcgac
acggtgctcgtgccgcgcgtctccgaagtgccgtcgcgctcgctgcgccagattgccgtg
gaccgcggcaagggcaatgttcccgagcgcgtggtgctcacaccgacctgcgagctcatg
cagatcgtcgtgctgtcgcgctcgatggacgagatcgcagaccgtgtggcgcatatgatc
gccggcacgaaggacggcaagcccgtgatcttcggcgaattcattgacttgtggcgcatc
acgaacatgctcaccgacgccgtgaagccggcgaaaaccgagaccgtgaacggctcgccg
gtgtatgtgcacggcggcccgttcgcgaacgtttccattggcattcctacgcttgtttcc
gttgagatggcgtgcgcgctgcacgacgtggtgatcgtcgaggccggctacggcgccgac
gccggcgcgcagaagtggcttgacatcgcatgccgtgaatacggcgcgcagtggccgagt
gccgcggttgtggtgactcgcgcgaccacttggcgcgacgatcctgccctgcagtggcgc
tacccgttccatgtcgatcgcttggagaagctcggcattcccaccttcccgctcatcaac
ctgtgggagggcgaggatgaccagattcccgccctgcgcgagactgcggaggaacttggc
ttccgtgacccgattgtgggcaatctgttccgcgatggcggcgaggcgctcgcaccgcag
ctcgatgcgttcgtcgaggccgtttccgacgaggcgctgcccgagcagccgaagagcttc
aagggcgagtcgttgcgcgagaagatcgagttcgtgtgtggcaatgcgtacggtgtgccg
gccgaccgtgtggtcgacaaggccggtttcgccgagtccgaggccgaggcggagcgcctg
tgcgccgacgccggcatcgacttcgccgatctcgccttggtggctgtgaagtcgccggcc
acgatgaccgacaacgacgccgcccccgccgacgagcgcaccgtgacgctcaagaaggtc
gaggcgcattcgggtgccggcctcgtgcaggtgaacctgaccacgagcctgaccaccccg
atgccgaagatcgtctga

DBGET integrated database retrieval system