KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_02025Help
Entry
BANAN_02025       CDS       T02047                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
Pathway
bni03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bni00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BANAN_02025 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bni03011]
    BANAN_02025 (rplV)
Ribosome [BR:bni03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BANAN_02025 (rplV)
  Bacteria
    BANAN_02025 (rplV)
  Archaea
    BANAN_02025 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AFI62625
Position
490902..491261
Genome map
AA seq 119 aa AA seqDB search
MEAKAIARHVRVTPRKARRMVDLIRGKKATEAITILKFAPQDASTPVLKVLQSAIANARV
KADKAGEPFRENDLYIKETYVDEGVTLKRFRARAQGRAARINKRTSHITVVVASKEGDR
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atggaagctaaagcaatcgctcgccacgttcgtgtgacgccgcgtaaggctcgccgcatg
gtcgacctcatccgaggcaagaaagcgaccgaagccatcaccattctcaagttcgctccg
caggacgccagcaccccggtgctcaaggtcctccagagcgccatcgcgaacgcccgcgtg
aaggccgacaaggccggcgagccgttccgtgagaacgacctgtacatcaaggagacctat
gtggacgagggtgtgacgctcaagcgtttccgcgctcgtgcacagggccgtgccgctcgt
atcaacaagcgtacgagccacatcacggtcgtcgtcgccagcaaggaaggagaccgctaa

DBGET integrated database retrieval system