KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_04590Help
Entry
BANAN_04590       CDS       T02047                                 

Definition
(GenBank) ABC-type transport system for Fe-S cluster assembly permease component
  KO
K09014  Fe-S cluster assembly protein SufB
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
Brite
KEGG Orthology (KO) [BR:bni00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    BANAN_04590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPF0051
Motif
Other DBs
NCBI-ProteinID: AFI63130
Position
complement(1083025..1084521)
Genome map
AA seq 498 aa AA seqDB search
MADNQAPHAARDVEMNQYIADRGRVNEDKLRQDDEIIEQFGEYSYGWHDSDAAGEAAKKG
IDENVVREISADKHEPEWMLDMRLRGYRAFIEQPMPKWGVDLSGFHAQDFKYYVKPVGKQ
AASWEDLPEDIRTTYDRLGIPEAEKSRLVSGVAAQYESEVIYNSIQDDLAKQGVIFVDTD
TAVREYPELVQKYFGTVVPPEDNKFGALNTAAWSGGSFVYVPKGVHVDIPLQAYFRINTP
NMGQFERTLIIADEGSYVHYVEGCTAPIYSTDSLHAAIVEIIVEKNARVRYTTVQNWSNN
VYNLVTQRAYVREGATMEWVDGNIGSKATMKYPACILAEPYASASTMSLGFAGKGQYQDT
GAKMIHLAPHTSSTIVAKSISRGGGRSAYRGLVKIVDGAEGSSSNVVCDALLVDDFSRSD
TYPHVDVREDDVSMAHEATVSKVSEDQLFYLMSRGIEEKEAMAMIVRGFVEPISRELPME
YALELNRLVELQMEGSVG
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
gtggcagacaaccaggcgccccatgccgcacgggatgtggagatgaatcagtacatcgcc
gatcgcggtcgcgtcaatgaagacaagctgcgacaggacgacgagatcatcgagcagttc
ggcgaatacagctacggatggcatgattccgacgccgcaggagaagcggcgaaaaaaggc
atcgatgagaacgtggttcgtgagatctcggcggacaagcacgaacctgagtggatgctc
gacatgcgtctgcgtggttaccgggcgttcatcgagcaaccgatgccgaaatggggtgtg
gatctttcgggattccacgcacaggatttcaagtactatgtcaagcccgtcggcaagcag
gccgcaagctgggaggacctccctgaggatatccgaaccacctacgacaggctgggcata
cccgaggccgagaagagccgcctggtttccggtgttgcggcccagtacgaatccgaggtc
atctacaactccattcaggatgatcttgccaagcaaggcgtcatcttcgtcgacaccgac
accgccgtacgtgagtacccggaactggtgcagaaatacttcggaacggtcgtcccccct
gaagacaacaaattcggggccctgaacacggcagcatggtcgggcggctcgttcgtgtat
gtgcccaagggcgtgcatgtggacattccgttgcaggcctacttccgcatcaacaccccg
aacatggggcagttcgaacgcacgctcatcatcgccgacgaaggctcctacgtgcattac
gtggaggggtgcacggcgccgatctactcgaccgactcgctgcacgccgcaatcgtcgag
atcatcgtcgagaagaacgcccgcgtccggtacaccaccgtgcagaactggtcgaacaac
gtgtacaatctcgtcacgcaacgcgcctacgtgcgcgagggtgccaccatggaatgggtc
gacggcaacatcggctcgaaggccaccatgaaataccccgcctgcatccttgccgaaccc
tacgccagcgcctccacgatgtcgctgggtttcgcaggcaaggggcagtatcaggacacc
ggtgcgaagatgattcacttggccccccacacctcttccaccatcgtcgcgaagtccata
tcgcgaggaggtgggcgttccgcctatcgaggactcgtcaagatcgtcgacggcgccgaa
gggtcgagctccaatgtggtgtgtgatgcgctgctggtcgatgacttctcacgttccgac
acctacccccatgtggatgtgcgcgaggacgacgtctcgatggcccatgaggcgaccgtc
tcgaaggtctccgaggaccagctgttctacctgatgagccgcggcattgaggagaaggag
gccatggcgatgatcgtgcgtggattcgtcgagccaatcagccgcgagctgcccatggaa
tacgcgctcgaactcaaccgtttggttgaattgcagatggaaggatcggtgggctga

DBGET integrated database retrieval system