KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_04595Help
Entry
BANAN_04595       CDS       T02047                                 

Definition
(GenBank) hypothetical protein
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YkuD PG_binding_4
Motif
Other DBs
NCBI-ProteinID: AFI63131
Position
complement(1084729..1086396)
Genome map
AA seq 555 aa AA seqDB search
MTFPSGNGGFSSNGANNQVPSDASDMRDFESTQVFTPMQDVPLPPQPPQQHASNAGMNGP
AAGKRHHVWPWIVVALVVVLAGACAGLVAFFNIRALPGTTLWGVDVSGKTQQQIVQTISN
EVDGTKIPVSYEGKTGSVTLSDLGVKVDAQQIAQEAVDAKRHENVFARYAPWAKHDVNPA
IDAKDANPEVLDEQLGTNSIKPVDAKLQVGDDGSTITVIEGTEGHGADPTETANEAVRVV
QSLGAQKPKTVEVQLKTISPAITTDEANKAKSTLDKLMAQKPGVYIGKERFAAFTPSMIL
AATTIDPNGNGTLPQGQIRNGNVVYDATVLQKAYDEQIKPNIKSTKEDREVIVNNNGTEI
EVIKEGHDGVTLDDGTDANIGTKAIDAFGKGNGTVSVSGKLDPMKVKETKRHVVVDLSDH
TVTALENGNAVKTMHMSAGQGNDYATGKCQASGDMCTPEGDFEIWLKYPSQNMSGTLTLS
DGKRETWDVKNVGFVNYFSKSGCAIHRIATQTPYTDAQIQALGENTSHGCVGIGWDMAEW
FYNWCVDGTSVHVQQ
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgacttttccatccggcaatggtgggttctcttcgaacggagccaacaatcaggtgcca
tcggatgccagcgacatgcgtgatttcgagtcgacgcaggtgttcacgccgatgcaggat
gtgccactgcctccacagcccccacagcagcacgcttccaatgcaggcatgaatgggcct
gccgcaggaaagaggcaccatgtatggccatggatcgtggtggcgctggtcgtcgtgctg
gcaggcgcctgtgccggtcttgtggcgtttttcaatatccgcgcgctgcccggcaccacg
ctctggggagttgacgtgtccggaaagacgcagcagcagattgtccagaccatttccaac
gaggtggacggcaccaagattccggtgagctacgagggcaaaaccgggtcggtcacgctg
tcggacctcggcgtcaaggtcgatgcacagcaaatcgcccaggaggcagtggatgcgaaa
cgccatgagaacgtattcgcccgatatgcaccatgggcgaagcatgacgtgaacccggcc
attgatgccaaggatgcgaatccggaagtcctcgatgagcagctgggcaccaacagcatc
aaacccgtcgacgccaagctgcaggtgggcgatgatggcagcaccatcacggtcatcgaa
ggcacggagggtcacggcgccgatccgaccgagaccgccaacgaggcggtgcgtgtcgtg
cagtccctgggagcgcagaaaccgaagaccgtggaggtgcagctcaagaccatctcgccg
gcaatcaccaccgatgaggcgaacaaggccaaatccacgttggacaaattgatggcacag
aagccgggcgtgtacattggcaaggaacggttcgccgcattcacaccatctatgatcctc
gccgcgacgacgatcgacccgaacggcaacggcacgctgccacaaggccagatccgcaac
ggcaacgtcgtctacgatgcgactgtcctgcagaaggcatatgacgagcagataaagccg
aacatcaagtccaccaaggaagatcgcgaggtcatcgtcaacaacaacggcaccgagatc
gaagtgatcaaggaaggccatgatggtgtgacactcgacgatggtacagacgccaacatc
ggcaccaaggcgatcgatgcgtttggcaaggggaacgggaccgtgtccgtttccggcaaa
ctcgacccgatgaaggtgaaggagacaaaacggcacgttgtggtcgatctctcggatcac
accgtgaccgctttggagaacggcaacgcggtgaagacgatgcatatgtccgcaggccaa
ggcaacgactatgccaccggcaaatgccaggcctcgggcgacatgtgcacgccagaaggt
gatttcgagatctggctcaaatacccatctcagaatatgtcgggcacgttgacgctttcg
gacggcaagagggagacgtgggacgtcaagaacgtcggcttcgtcaactatttctcgaag
agcggctgcgccatccatcgcattgccacgcagaccccatacaccgatgcgcagattcag
gccttgggtgagaacacctcccacggttgcgtcggcatcggctgggacatggcggaatgg
ttctacaactggtgcgtggatggcaccagcgtgcacgtccagcaataa

DBGET integrated database retrieval system