KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_04600Help
Entry
BANAN_04600       CDS       T02047                                 

Definition
(GenBank) hypothetical protein
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AFI63132
Position
complement(1086393..1086512)
Genome map
AA seq 39 aa AA seqDB search
MKNARNMVMNRLLFMTMLHNMDRPNSFWDFFGECFQGAI
NT seq 120 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatgcacgaaacatggtcatgaaccgcttgctgttcatgaccatgttgcataat
atggacaggcccaattccttttgggatttctttggggagtgttttcaaggagcaatatga

DBGET integrated database retrieval system