KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_04640Help
Entry
BANAN_04640       CDS       T02047                                 

Definition
(GenBank) hypothetical protein
  KO
K02654  leader peptidase (prepilin peptidase) / N-methyltransferase [EC:3.4.23.43 2.1.1.-]
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
Brite
KEGG Orthology (KO) [BR:bni00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bni01002]
    BANAN_04640
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bni02044]
    BANAN_04640
   02035 Bacterial motility proteins [BR:bni02035]
    BANAN_04640
Enzymes [BR:bni01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     BANAN_04640
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.43  prepilin peptidase
     BANAN_04640
Peptidases [BR:bni01002]
 Aspartic Peptidases
  Family A24: type IV prepilin peptidase family
   BANAN_04640
Secretion system [BR:bni02044]
 Type II secretion system
  General secretion pathway protein [MD:M00331]
   BANAN_04640
  Pilin secretion/fimbrial assembly protein
   BANAN_04640
  Type IVa pilus homolog protein
   BANAN_04640
Bacterial motility proteins [BR:bni02035]
 Pilus system
  Pilus assembly proteins
   BANAN_04640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_A24 MmgE_PrpD
Motif
Other DBs
NCBI-ProteinID: AFI63140
Position
1096955..1097413
Genome map
AA seq 152 aa AA seqDB search
MVCGLAISVTDLRRRIVPRPWVMAGVAVQCAVFLAVGIRSHDLWPFVCACFGLMGAVGVQ
LSLAMAIPRHALGLGDVTASGMAGFATGYFGLECFLWFWLCMGVLGVGWVPAYSVYSRVR
SRGRTGDGVGRLRVPFVPVIATAAALAVMCCA
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
ttggtctgtggactcgcgatctcggtcaccgacctgaggcgccgcattgtgccgcgccca
tgggtcatggcaggtgtggccgtgcaatgcgcggtcttcttggcggtggggattcgctcg
cacgacctgtggcccttcgtctgcgcctgcttcgggctgatgggtgcagtcggagtgcag
ctttcgcttgccatggcgatcccccgtcatgcgcttggtcttggtgatgtcacggccagt
ggcatggcgggattcgccacggggtatttcggactcgaatgctttctgtggttctggctg
tgcatgggcgtgctcggtgtaggttgggtgcccgcctattccgtgtattcccgggtacgt
tcgcgtggacgcaccggtgatggggtgggacgtctgcgggtgccgttcgtcccggtgata
gccacggcggctgcacttgccgtcatgtgttgtgcatga

DBGET integrated database retrieval system