KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_04645Help
Entry
BANAN_04645       CDS       T02047                                 

Definition
(GenBank) hypothetical protein
  KO
K07082  UPF0755 protein
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
Brite
KEGG Orthology (KO) [BR:bni00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    BANAN_04645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YceG Herpes_US9 DUF3324
Motif
Other DBs
NCBI-ProteinID: AFI63141
Position
complement(1097465..1098646)
Genome map
AA seq 393 aa AA seqDB search
MSDDLHDFFNADESWDDGAEPAPMPPIPPHSRREMRRQRAMRKRRNLIICIIVIIALALI
SVGGVFAYRAARNWRRANMAHESLVEDYPGPGDTDVAFTVKQGEGIMEVGANLVQQQIVK
SADTFATYVSSNDKTLYPGTYALKTHMKASQAADILSDQGNAKGFAEVRQGERVSTVIER
ICADNDIDKTRFEAIVNNRDEASKILPAEANGNFEGWLEPGTYTVGDVATAPERLLKEMV
DARIRKLDEMGVPQGAERERMLIIASIVEAEVNSSDYYSKVSRVIYNRLDKDMTLGMDST
VAYGAGINGMQLTNDQLQDTSNPYNTRVNRGLPPTPISNPGDDAIEAAMHPADGNWLYFV
TTDLKTGETKFADTDGQFQQLVQEYRRNNPDAN
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgacgacctgcatgatttcttcaatgccgacgaatcctgggacgatggcgccgaa
ccggctcccatgccacccatccctccccatagcaggcgcgagatgcgacgccaacgcgcg
atgaggaaacgcaggaatctcatcatctgcatcatcgtcatcatcgccctcgccctcatc
tcggtcggtggggtgttcgcataccgggccgcacggaactggcgtcgtgcgaacatggcc
catgaatccctcgtcgaggattatccgggaccgggagacaccgatgtcgccttcaccgtc
aagcagggcgagggcatcatggaggtgggtgccaatctggtgcaacagcagatcgtcaag
tcggcagacaccttcgccacctacgtttcctcgaacgacaagacgctgtatccgggcacc
tatgcattgaagacgcatatgaaggcgtcacaggcggcggacatactctccgaccaaggc
aacgcgaaaggcttcgcggaggtgcggcagggcgaacgagtgtccaccgtgatcgaacgg
atctgcgccgataacgacatcgacaagacacggttcgaagcgattgtcaacaacagggac
gaggcgtcgaagatccttcccgcagaggcaaacggcaacttcgaaggctggctggagccc
ggcacctacactgtgggggatgtcgcgaccgctcccgagcggctgctcaaagagatggtg
gacgcgcgcattcgcaaactcgacgagatgggcgttccccaaggcgcggaacgcgagcgc
atgctcatcatcgcttccattgtggaggcggaggtgaactcatcggactactacagcaag
gtgagcagagtgatctacaatcgtctcgacaaagacatgacgctcggcatggacagcacc
gtggcctatggcgctggcatcaacggcatgcaactgaccaacgaccagctgcaagacacc
tcgaatccctacaacacccgcgtgaatcgcggtctgccgccgacaccgatcagcaatccg
ggtgatgacgccatcgaagcggccatgcaccccgccgacggcaattggctgtacttcgtg
accaccgatctgaagaccggtgagacgaaattcgctgacaccgacggacagttccagcag
cttgtccaggagtaccggaggaacaacccggacgcgaactga

DBGET integrated database retrieval system