KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_04680Help
Entry
BANAN_04680       CDS       T02047                                 

Gene name
rpsD
Definition
(GenBank) 30S ribosomal protein S4
  KO
K02986  small subunit ribosomal protein S4
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
Pathway
bni03010  Ribosome
Module
bni_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:bni00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BANAN_04680 (rpsD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bni03011]
    BANAN_04680 (rpsD)
Ribosome [BR:bni03011]
 Ribosomal Proteins
  Bacteria
   Small subunit
    BANAN_04680 (rpsD)
  Archaea
    BANAN_04680 (rpsD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S4 S4 S4_2 Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: AFI63148
Position
complement(1103824..1104444)
Genome map
AA seq 206 aa AA seqDB search
MSNRSRRQVRLSRALGIALTPKAQRIFEKRPYAPGEHGRTRRRAESDYAVRLREKQRLRA
QYGISEKQLRAAYEKGTHTAGQTGNAMLTDLETRLDALVLRAGIARTTAQARQFVVHRHI
LVDGNIVDRPSYRVKPGQTIQVKPKSQTMVPFQIAAEGTHRDVLPPVPGYLDVNLASLKA
TLTRKPEPEEIPVQVNIQYVVEFYAR
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaatcgttcccgccgtcaggtgcgtctttcccgcgccctcggcatcgcgctgacc
ccgaaggcacagcgcatcttcgaaaagcgtccgtatgccccgggtgagcatggccgtacc
cgccgccgcgctgagtccgattacgcagtccgtctgcgcgagaagcagcgtctgcgcgct
cagtatggcatctcggagaagcagctccgcgctgcctatgaaaagggcacccacaccgca
ggccagaccggcaacgcaatgctcaccgatctggagacccgcctcgacgccctcgtgctg
cgtgccggcattgcccgcaccaccgcacaggcccgccagttcgtggtgcaccgtcacatc
ctcgtcgacggcaacatcgtcgaccgcccgtcctaccgcgtcaagcccggccagaccatc
caggtcaagccgaagagccagacgatggttccgttccagatcgcagccgaaggcacccac
cgcgacgtcctgccgccggtgccgggctatctcgatgtgaacctcgcctcccttaaggcg
acgctaacccgcaagccggagccggaggagatcccggttcaggtgaacatccagtacgtg
gtcgaattctacgcccgctga

DBGET integrated database retrieval system