KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_04710Help
Entry
BANAN_04710       CDS       T02047                                 

Definition
(GenBank) bifunctional beta-cystathionase/maltose regulonrepressor
  KO
K14155  cystathione beta-lyase [EC:4.4.1.8]
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
Pathway
bni00270  Cysteine and methionine metabolism
bni00450  Selenocompound metabolism
bni01100  Metabolic pathways
bni01110  Biosynthesis of secondary metabolites
bni01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bni00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BANAN_04710
  Metabolism of other amino acids
   00450 Selenocompound metabolism
    BANAN_04710
Enzymes [BR:bni01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.8  cystathionine beta-lyase
     BANAN_04710
Amino acid related enzymes [BR:bni01007]
 Aminotransferase (transaminase)
  Class II
   BANAN_04710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AFI63152
Position
1110856..1112055
Genome map
AA seq 399 aa AA seqDB search
MDIDERIAQFDSPVDRTGIFSMKWDVADGELPMWVADMDFRTAPAISEALTERVGNGTFG
YTDVPREWNEAVADWWLRRYGVTVDPEHVVFTTGVIPAISSLVRSLTNVAEKVVLQPPVY
NIFTNSIVNNGRRVLCNPLRYEHGAYSMDFDDLEHKLADPLTRLMILCNPQNPSGNVWSD
GDLARVGELCAKHHVTVVSDEVHGDIVRPGVTHMPFAAVNELNRSICVTCSSPSKAFNVA
GLQSAYFICDDDGLRARAVRGVNTDEVAEPNDFAVFSTIAAYTDGGAWLDDLCRVVQRNK
DYVSAQLDEHAHDMLHMVASDSTYLAWIDCSGLLDRVGDANAERFCGFLRSHTGLVLSYG
GIYGENGSRFVRMNLGTRADLVIDGTARLLAGAAAYLGN
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggacattgacgagcgcattgcacaattcgactcccctgtcgaccgcacgggcatcttc
tcgatgaaatgggacgtggccgacggcgaactgccgatgtgggtggcggacatggatttc
cgcacggctccggcgatcagcgaggcattgactgaacgcgtgggcaacggcaccttcggc
tatacggatgttccccgggaatggaacgaagcggtcgcggattggtggctgcgtcggtat
ggcgtgacggtggatcctgagcatgtggtgttcaccaccggtgtgattccggcaatctcc
tcactggtccgctcgctgacgaatgtggccgagaaggtcgtgctccaaccgccggtctat
aacatcttcacgaattcgatagtgaacaacgggcgccgggtactgtgcaaccctctgcgt
tatgagcacggcgcgtactcgatggatttcgacgacctcgagcacaagctcgccgatccg
ctcacccgtctgatgattctgtgcaatccgcagaatccgagtggcaatgtgtggagcgac
ggcgatctggcgcgcgtaggcgagctgtgcgcaaaacaccatgtgacggttgtttccgat
gaggtgcatggcgacatcgtgcgcccgggtgtcacccatatgccattcgccgcggtcaat
gagctgaaccgttcaatctgcgtgacctgctcgtcaccatcgaaggccttcaatgtggcc
ggactgcagtccgcatatttcatctgcgacgatgacggtctccgggcacgtgccgtgcgc
ggcgtgaacaccgacgaggtggccgagccgaacgatttcgccgtgttctccacgatcgcc
gcctataccgatggaggcgcgtggctcgacgatctgtgccgtgtcgtgcagcgcaacaag
gactacgtgtcggcgcaacttgacgagcatgcgcatgacatgctgcatatggtggcctcg
gattccacatatctggcatggatcgactgctcgggccttcttgatcgtgtgggcgacgcc
aatgctgagcgcttctgcggttttctgcgttcacataccggtcttgtgctctcgtatggc
ggcatctacggcgaaaacgggtcccggttcgtacgcatgaatctcggcacccgcgccgat
ctggtcatcgacggcacggcgcgcctgctcgccggcgccgcggcgtatctgggaaactaa

DBGET integrated database retrieval system