KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_04730Help
Entry
BANAN_04730       CDS       T02047                                 

Definition
(GenBank) putative amidotransferase subunit
  KO
K07010  putative glutamine amidotransferase
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
Brite
KEGG Orthology (KO) [BR:bni00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bni01002]
    BANAN_04730
Peptidases [BR:bni01002]
 Cysteine Peptidases
  Family C26: gamma-glutamyl hydrolase family
   BANAN_04730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_C26 GATase GATase_3 GATase_5
Motif
Other DBs
NCBI-ProteinID: AFI63154
Position
complement(1114779..1115426)
Genome map
AA seq 215 aa AA seqDB search
MLPGYMNALRQAGAVPFMPALTTDRQETDQIFGMCDGLVMTGGHDVNPECYGESDRYGNL
HCCDARDEMELALLERAVASDKPVLGICRGLQIMNVFCGGTLYQDLPSEHPSDVDHHQHP
PYDRPAHHVHILSRTPLREDLHDTDLAVNSRHHQAICKLGEGLDPMAISEDGLVEAIYRP
RSAFYRAVQWHPEHLYKIDEPSRCIFRSFVNACTL
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgcttcccgggtacatgaatgcattgcgtcaggccggtgcagtgccgttcatgcctgca
ttgacgaccgatcgacaggagaccgaccagatcttcggcatgtgcgacggtcttgtgatg
actggtgggcatgacgtgaatccggaatgctacggcgaatcggaccgatacggcaatctg
cactgctgcgatgcgcgggatgagatggaactcgcgttgcttgaacgtgccgttgcaagc
gacaaaccggtgctcggcatatgccgtggtctgcagatcatgaacgtcttctgcggaggg
acgctgtatcaggatctgccgagcgaacatcccagcgacgtcgatcatcatcagcaccca
ccctatgatcggccggctcaccatgtgcacattctaagcaggacgcccctgcgagaagat
ttacacgacaccgaccttgcggtcaacagccgacatcatcaggccatctgcaagctgggc
gaggggctggatccgatggcgatcagcgaggatggtctcgtggaagcgatctacagacct
cgaagtgcattctatcgtgctgtgcaatggcaccctgaacatctatataaaatagacgaa
ccaagcaggtgcatattccgctccttcgtgaacgcctgcacactctga

DBGET integrated database retrieval system