KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_04765Help
Entry
BANAN_04765       CDS       T02047                                 

Definition
(GenBank) hypothetical protein
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_16 AAA_22 AAA_14 KdpD ATPase_2 AAA_5 DAP3 TrwB_AAD_bind
Motif
Other DBs
NCBI-ProteinID: AFI63161
Position
complement(1120598..1121791)
Genome map
AA seq 397 aa AA seqDB search
MEVSTKALNPFMPGSGKSPRDLVGRDADLADMEQLLVRTELGFVDRGMIYSGLRGMGKTV
LLLQFAKQARAHGMMVVQCEANGDARKEYDAIFHELMMATQRMRDRALREALKNAFSYVK
DLSFDFGIVKATVDTEPQDAQIQTDAYRLELLVEELSRQLKACKSGLFMFVDELQEMSDE
VLGALIGIQHRMGQQDLPFFIVGAGLPNLPGVLTKLRSYAERLFTYHRLGSLSKEASALG
FQSPAQEAGRSFDDTALAELVERSMGYPYFIQAYGSATWDAADSSPMTIDAVERGLPGAW
RTLDQGLYISRWQRASELGRDYMAAMAAEDADAVDTADVARSLGRPNSSLTNVRNQLIEL
GLIYAPRRGQVAFTVPGMDAYIKRALPVRVEPYETGE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggaggtttccacgaaggcgctcaacccgttcatgccgggatcgggcaagtcgccgcgc
gatcttgtcgggcgtgatgccgatttggcggatatggaacaattgctcgtccgtacggag
ctggggttcgtcgatcggggcatgatctacagcggtctgcgtggcatgggcaagacggtg
ctgctgctgcagttcgcgaaacaggcccgcgcgcatggcatgatggttgtgcaatgcgag
gcgaacggggacgcgcgcaaggaatacgatgccatcttccatgaattgatgatggcgacg
caacgcatgcgcgaccgcgcgttgagggaggcgttgaaaaacgcattctcgtatgtgaag
gacctgtcattcgatttcggcatcgttaaggcgacggtggatacggaaccgcaggacgcc
cagatacagaccgatgcgtaccgtttggagctgcttgtcgaggagttgtcgaggcagctc
aaggcgtgcaagagcgggttgttcatgttcgtcgatgaattgcaggagatgtccgacgaa
gtgcttggcgcgctcatcggcatccagcaccgtatggggcagcaggatcttccattcttc
atcgtgggcgcaggattgcccaatctgccaggcgtgctcaccaaactacgttcttacgcg
gaacgcctgttcacgtaccatcggcttggatcgctctcgaaagaggcgagtgcgctggga
ttccagagccccgcgcaggaggcgggcaggtcgttcgacgatacggcgttggccgagttg
gtggaacgcagcatggggtatccgtatttcattcaggcgtatggttcggccacatgggac
gctgcagattcaagtccgatgacgatagatgcggtcgaacgcggcctgccgggagcatgg
cgtacgttggaccaaggcctctacatctcccgttggcagcgtgcaagcgaattgggacga
gactatatggcggcgatggccgctgaagacgccgatgctgtggacaccgccgatgtggcc
cgaagtcttggtcggccgaactcttcgttgacgaacgtgcgcaatcaactcatcgaattg
ggattgatctatgcaccacggcggggtcaggtggcgttcaccgtccccggtatggatgcg
tatatcaagcgtgcgttgccggtgcgtgtcgaaccatatgagaccggcgaatga

DBGET integrated database retrieval system