KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_04770Help
Entry
BANAN_04770       CDS       T02047                                 

Definition
(GenBank) hypothetical protein
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: KTI12 CbiA Zeta_toxin AAA_22 AAA_30 AAA AAA_33 ArgK AAA_16 AAA_18 Thymidylate_kin APS_kinase ParA SRP54 DUF2075 AAA_31 T2SSE NACHT TrwB_AAD_bind AAA_17 MipZ NTPase_1 AAA_19
Motif
Other DBs
NCBI-ProteinID: AFI63162
Position
1121945..1122601
Genome map
AA seq 218 aa AA seqDB search
MSAHEINTRLIIVEGLPGSGKSTTAAMVAAELEARGKDVVCVDEGAANHPADVGDYDFPD
FASERATILDTWRAFAAHAEPDTTYVFNCVLLQNPMCETMMRFGMNEDESRRYIGEITAI
IAPLHPVIIYIDEPDAKSAIDGVLDERGDGWLNAVIDYHTAQGYGEAHGLRGYEGYIACL
EERRERELRILRSLPVDSHIIAPLSDAKRISTVVDAIP
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcacatgagataaacacccgtctgatcatcgtcgaaggactgccaggcagcggc
aagagcacgacggccgcaatggtcgccgccgaactcgaagcgcgggggaaggacgtcgtc
tgcgtcgacgaaggagccgcgaaccaccccgccgatgtcggcgactacgacttccctgat
ttcgcgagcgaacgcgccacgatactcgatacatggcgcgcgttcgcagcccacgccgaa
cctgatacgacctacgtgttcaattgcgtcctgctgcagaatccgatgtgcgagacgatg
atgcggttcggcatgaacgaggatgagtcacgacggtatatcggtgaaatcacggcgatc
atcgcgccgctgcatcccgtcatcatctacatcgacgaaccggacgcgaagtcggctatt
gatggtgtcctcgacgaacgcggcgatggttggctcaatgccgtcatcgactaccacacg
gcacaagggtacggtgaagcgcatgggttgcgcggatacgaagggtacatcgcgtgcctt
gaagagcgcagagagcgggagctgcgcatcctacgttcacttccggttgacagccacatc
atcgcgccattgagcgatgccaaacggatatcgacggtggtggatgcgataccgtga

DBGET integrated database retrieval system