KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_04790Help
Entry
BANAN_04790       CDS       T02047                                 

Definition
(GenBank) hypothetical protein
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FUSC_2 YtpI DUF3367
Motif
Other DBs
NCBI-ProteinID: AFI63166
Position
1124275..1125345
Genome map
AA seq 356 aa AA seqDB search
MDAHGLWAKVKATTEPRTKARLIFAMSIRSILLVSFAVVFIGGLSAVFGPDNSGLAVAGF
CILLGIKHVPYGYRATDSVIALAFVLAAMVCGGLAAQAWPPVPCLMVNFLLITVILVLVA
DEPLMGNAGLYVFGYLFVSQTPVNGEALASRCVLALLLWLACSAVLLHKHHGKFQNVRLY
DMLAAFSVSSAKGLWQIRLSAGVAMALLIGELAGLPRGVWVGYACMSVLLPFGEAGTSLP
MRALQRIGGVVVGSLLYAGFSLVVPAGSRILFGPIAGICMGFSSKYMVNNALNCFGALLL
AESVYGVSGSVTLRIYDNMIGALFAVCCTVLFSLLERHASSDEAPATNRTKPSTNI
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggatgcccatgggctatgggcgaaagtgaaggcgaccacggaaccgcgaacaaaggct
cgtctcatcttcgccatgtcaatcaggagcattctgctcgtctccttcgccgtcgtattc
atcggcggtttgtcggcggtgttcggccccgataactccgggctggccgtggcgggattc
tgcatcctgctcggcatcaagcatgttccttatggataccgcgccacggacagtgtcatc
gctctggcgttcgtcttagcggccatggtgtgtgggggactggcggcccaggcatggccg
ccagtcccctgtctgatggtgaacttcctgctcatcaccgtcatcctggtactcgttgcc
gacgagccactgatgggcaacgccgggctctatgtgttcggatacctgttcgtgagccag
acgcctgtgaatggggaagcgctcgcaagccggtgtgtgctggcgttgctgctgtggctg
gcatgcagcgccgtgctcctgcacaagcaccacgggaagttccagaatgttcgtttgtat
gacatgctggctgcattcagcgtatccagcgcaaagggactctggcagatcagactgtcc
gcaggggtggccatggctttgctcatcggggaactggcaggactgccccgaggcgtatgg
gtgggctatgcctgcatgtcggtgcttctccccttcggcgaagcgggaacgagcctgcca
atgcgagcgctgcagcgcataggcggagttgtcgtgggatcattgctatatgccggattc
tcgcttgtggtaccggccgggtcccgcatcctgttcggccccatcgcaggcatctgtatg
ggattctccagcaagtacatggtaaacaacgccctcaattgtttcggcgccctcctgctt
gccgagagcgtctacggcgtctccggatctgtgacgttgcggatctacgacaacatgatt
ggtgcgctcttcgcggtatgctgcaccgtgctgttctcacttctggaacgccatgcctcc
tccgatgaagcaccggcaaccaaccgcaccaagccgtcgacgaatatataa

DBGET integrated database retrieval system