KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_04840Help
Entry
BANAN_04840       CDS       T02047                                 

Definition
(GenBank) DNA polymerase I
  KO
K02335  DNA polymerase I [EC:2.7.7.7]
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
Pathway
bni00230  Purine metabolism
bni00240  Pyrimidine metabolism
bni01100  Metabolic pathways
bni03030  DNA replication
bni03410  Base excision repair
bni03420  Nucleotide excision repair
bni03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bni00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BANAN_04840
   00240 Pyrimidine metabolism
    BANAN_04840
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    BANAN_04840
   03410 Base excision repair
    BANAN_04840
   03420 Nucleotide excision repair
    BANAN_04840
   03440 Homologous recombination
    BANAN_04840
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bni03032]
    BANAN_04840
   03400 DNA repair and recombination proteins [BR:bni03400]
    BANAN_04840
Enzymes [BR:bni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     BANAN_04840
DNA replication proteins [BR:bni03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     BANAN_04840
DNA repair and recombination proteins [BR:bni03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA polymerase I
     BANAN_04840
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     BANAN_04840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol_A 5_3_exonuc_N 5_3_exonuc DNA_pol_A_exo1
Motif
Other DBs
NCBI-ProteinID: AFI63176
Position
complement(1140201..1143083)
Genome map
AA seq 960 aa AA seqDB search
METNEQGTNGTLLVIDGHSLAFRAFYALPAENFSAKDGQATNAVYGFFTMLSQVIASQKP
DLLGVAFDVKGGTFRNKMLTQYKGTREAAPEELISQIPLIQDMLEAFGVTYVTKQGYEGD
DVIATLATMGEHADYRTYVLSGDRDAFQLIDDDITVLYPGYHFKELKAMTPQAVEDKYHV
TPRQYPDLAALRGETADNIPGVPGVGDGFAAKWINQYGGLDGVIEHADEIKGKKGDALRE
SIEQVRLNRKVNALVRDLDLGVDIADLTFGKVDPAKAEELFNQLNFGARIRSKLLKTFNA
GDPGHPVAKKASAAERFEFDGEFDDGSFDTPESVRVQEPVVDEIGDAASLEVWAQQHCPI
ASGKGISSTTLDVVGEYDAQSQQCVDAVDGSWSLFASGSPKPGRSSISGLALMADGHAVV
VDPHDEQYHTALQRILDTYAATLSVHGYKEHLHMLGAVNLRLPMVLFDTNLAGYLIDPDF
QGGSLQDCADHFLHLHAEEVTEPEQGTLDIEMDDERAERDRKVVRNVAIASLLARTLARP
LEQRCQYSLLRDIELPTSVVLFHMEHTGASVDRARLDELLEMFTDESDRMEQICYEAAGH
EVNLQSPKQLGVVLFEEMKLNPTKKTKRGSYSTNAKALTTLYAASEEGSRPNEFLGALLR
HREVNKLRQIVQTLIDAINPRDGRIHTTFTQTVAATGRLSSVDPNLQNIPNRNAAGRDIR
SAFVPSEGFADLLSADYSQVELRIMADLSGDETLIKAFKSGADFHRYVASMVYGIPVDEV
TPDQRSHVKAMSYGLAYGLSTYGLSQQLGIPSKEAAALRSRYFQTFGKVHDYLESLVFNA
RNTGYTQTMFGRRRYFPALTSANRVARDAAERGALNAPIQGTAADIMKIAMIRADRALRD
GNLNSRIVLQIHDELVVELAPGEEKRVTELVRDAMEHAVNIAVPLDVSTGVGFDWQQAAH
NT seq 2883 nt NT seq  +upstreamnt  +downstreamnt
atggaaacgaatgaacagggcaccaacggaacgttgctggtgatcgatggccattcgctg
gcattccgtgcgttctacgcactgccagcggagaatttttcggccaaagacggtcaggcc
accaatgcagtctatggcttcttcacgatgctttcgcaggtcattgcatcgcagaagccc
gatctgctcggcgtggccttcgacgtgaaggggggcaccttccgcaacaagatgctcacc
cagtacaaaggcacacgtgaagcagcccctgaagaactcatctcgcagattccgctcatc
caggatatgcttgaggcgttcggtgtgacctatgtgaccaagcagggatacgagggcgac
gatgtgattgccacgctggccacgatgggggagcatgcggattaccgcacctatgtgctg
tccggagatcgtgatgcattccagctcatcgatgacgacatcacggtactgtacccgggc
tatcatttcaaggaactcaaggccatgaccccgcaggccgtggaggacaaataccatgtc
accccgcgccaataccccgatctggcagcattgcgcggtgagaccgccgataacataccg
ggtgtgccgggtgtgggtgacggcttcgccgccaagtggatcaaccaatacggtggtttg
gacggtgtgatcgaacatgccgacgagatcaagggcaagaaaggcgacgcgctgcgtgag
agcattgaacaggtcaggctcaaccgcaaggtgaacgccttggtgcgtgatctggaccta
ggtgttgacattgccgacctcaccttcggcaaagtggatcccgccaaggcggaggagctg
ttcaaccaactcaacttcggcgcacgcattcgaagcaaactgctcaaaaccttcaatgcg
ggggatcccggccacccggtcgcgaaaaaggcctctgccgcggaacggttcgaattcgac
ggggaatttgacgacgggtcgttcgacacccctgaatcggtgagggtgcaggaacccgtg
gtggatgaaatcggggacgccgcgtcactcgaggtgtgggcccaacaacactgtcccatc
gcctcgggcaagggcatctcgtcaaccacattggatgtggtgggcgaatacgacgcacag
agccagcaatgcgtcgatgccgtggatggttcctggagtctgttcgcatcgggaagcccc
aagccgggccggtcttcgatctcgggactggcgttgatggccgacggtcatgcggtggtg
gttgacccgcatgacgagcagtaccatacggctctgcagcgtattctcgacacctatgct
gccacgctgagcgtccacgggtacaaggaacatctgcacatgcttggtgctgtgaacctg
cgattgccgatggtgctgttcgacaccaacctcgccggatatctcatagacccagatttc
caaggaggatcgctgcaggattgtgccgatcacttcctgcatctgcacgctgaggaagtg
acggaacccgaacagggcaccctcgatatcgaaatggatgacgaacgcgccgaacgtgac
cggaaggtggtgcgcaatgtcgccattgcgagcctgctggcccgcacgttggctcggccg
cttgaacaacgctgccagtacagcctgttgcgcgatatcgaattgcccacctcggtggtg
ctgttccatatggagcacaccggagccagcgtggaccgtgcccgtctcgatgaattgctg
gagatgttcaccgacgaatccgaccgcatggaacagatctgttatgaggccgcaggccat
gaggtgaatctgcagagtcccaagcaactcggtgtggtgctgttcgaagagatgaagctc
aatcccaccaagaagacgaaaagaggctcgtactccaccaatgccaaggcgctcaccacc
ttgtacgcggcctccgaggaggggagccgccccaacgagttcctcggagcattgctgcgg
catcgtgaggtgaacaaactacgtcagatcgtgcagacgctcatcgacgccatcaatccg
cgcgatgggcgtattcacacgacgttcacgcagacggtcgccgcaacgggacgtctgagt
tccgtggacccgaatctgcagaacattccgaaccgcaatgctgccggccgtgacatccgc
tcggccttcgtacccagtgaggggttcgcagacctgctcagcgccgactattcgcaggtg
gagctgcgcatcatggcggatctgtcgggtgacgagacgctcatcaaggcattcaagtca
ggggcggacttccaccggtatgtggccagtatggtgtacggcatcccggtcgacgaggtg
acgcccgaccaacgcagccacgtgaaggcgatgagctatgggctggcctacgggttgagc
acctatgggctctcgcagcagctgggcatcccgtcgaaggaggcggctgcactgcgatcg
cggtatttccagaccttcggcaaagtgcatgattatctggagtcgctggtattcaatgcc
cgcaataccggctatacgcagacgatgttcggccggcggcgctatttccccgccttgacc
tcggccaaccgggtggcacgcgatgccgcagaacggggtgcactgaacgccccgattcag
ggcactgccgcagacatcatgaagatcgcgatgatccgcgcggatcgcgctttgcgggac
ggcaacctgaacagccgcatcgtgttgcagatccacgatgaactggtggtggagctggcg
cccggcgaggagaagcgtgtgactgagctggtgcgtgatgcgatggagcatgcggtcaac
atcgccgtgccgcttgacgtgtccacaggcgtggggttcgattggcagcaggctgcccac
taa

DBGET integrated database retrieval system