KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_04850Help
Entry
BANAN_04850       CDS       T02047                                 

Definition
(GenBank) NTP pyrophosphohydrolase including oxidative damage repair enzyme
  KO
K01515  ADP-ribose pyrophosphatase [EC:3.6.1.13]
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
Pathway
bni00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:bni00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BANAN_04850
Enzymes [BR:bni01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.13  ADP-ribose diphosphatase
     BANAN_04850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX
Motif
Other DBs
NCBI-ProteinID: AFI63178
Position
complement(1144054..1144683)
Genome map
AA seq 209 aa AA seqDB search
MSKQTYRRFDPWRSTPIHEEARETIVGGHYFNIDRVSFASPTVGHFERLILHKNNGDSVG
VIGLTKDGRVPLIEQYRIPVHRWTLEIPAGHAIDKNEKPVDVARRKLAEEVGYKAGVMTQ
FCRFINTPSYSTQHTALYFAYDLEPIDEREQYANEARAQVRFLTPQECYDLVLNGTILDA
KSIIAIQRLYMAPNNMIGVSPDDEAPARD
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagcaaacataccgtcgcttcgatccatggcgcagcacccccatccatgaggag
gcgcgcgagaccatcgtcggtggtcattacttcaacatcgaccgcgtgtcgttcgcctcg
ccgacggtggggcatttcgaacggctcatcctgcacaagaacaatggcgattccgtgggg
gtgatcggcctgacgaaggacggcagggtgccgctcatcgaacagtaccgcatccccgtg
catcggtggactctggagattcccgcaggacatgcgatagacaagaacgagaagccagtc
gatgtggcccgtcgcaagcttgccgaggaggtggggtacaaagcgggggtgatgacacag
ttctgccgcttcatcaacaccccaagctactccacacagcataccgccctctacttcgcc
tatgatctcgaaccgatcgacgaacgcgagcagtacgccaacgaggcccgcgcgcaggtt
cgtttcctcacaccgcaggaatgctatgatctggtgctcaatggaacgattctcgatgcc
aagtccatcatcgccatccaacgcctgtatatggcgccgaacaacatgatcggtgtttcc
ccggacgacgaagcgccggcccgagactga

DBGET integrated database retrieval system