KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_04860Help
Entry
BANAN_04860       CDS       T02047                                 

Definition
(GenBank) Integral membrane protein TerC
  KO
K05794  tellurite resistance protein TerC
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
Brite
KEGG Orthology (KO) [BR:bni00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    BANAN_04860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TerC UPF0640
Motif
Other DBs
NCBI-ProteinID: AFI63180
Position
complement(1146653..1147642)
Genome map
AA seq 329 aa AA seqDB search
MIGTYVVLVVFFVVDLFVLGRRPHVPSTKECVQHIAFFVAMALVFGGLIWWVAGAKPAVE
FYSGWLTEYSLSIDNLFVFVIIMSNFAVPKKLQKFVLSVGITIALVLRGLFILIGAALVS
RFTWVFFIFGAFLIYTAVKVAIGEDDDEEFHENGLIRLMRRFSHVTNEYDGERLRTTIDG
RKYWTPMLIVFITIGTTDVMFAFDSIPAIFGLTKDPFIVFTSNVFALLGLQQLYFLLGRL
LDKLVYLPVGLSLVLGFIGVKLILEALHGNTLPFINHGQPLGMVPEVPTWLSLVVIIVCI
GGSALASVIKMKSIDAKQAAAPSNPQERP
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgatcggcacctatgtcgtgctggtcgtcttcttcgtcgtggatctcttcgtcctgggg
cgcaggcctcatgtaccgtcgaccaaggaatgcgtgcagcacattgcgttcttcgtcgcc
atggcgctcgtcttcggcggattgatatggtgggtggccggggccaagccggccgttgag
ttctactcgggctggctcaccgagtattcactcagcatcgacaacctcttcgtgttcgtc
atcatcatgtcgaacttcgcggtgccgaagaaactgcagaagttcgttctctcggttggc
atcacgatcgcattggtgctccgtgggctgtttattctcatcggagccgccttggtctcg
cggttcacctgggtgttcttcattttcggcgccttcctcatctatacggccgtcaaagtg
gcgataggggaggacgacgatgaggagttccatgagaacggactgattcgcctcatgcgg
cgattctcccatgtcacgaatgaatacgacggcgagaggctgcgcaccaccatcgacggt
aggaagtattggacccccatgctcatcgtgttcatcacgatcggcaccaccgacgtcatg
ttcgctttcgactcgattccggcgatattcggtctcaccaaggatccgttcatcgtgttc
acctccaatgtgttcgcattgctcggcctccagcagctgtacttcctgctggggcgcctg
cttgacaagctggtgtatctgccggtcggcctgtcgcttgtcctcgggttcatcggtgtc
aaactcattctcgaggcattgcatggcaacacgcttccgttcatcaaccacggccaaccg
ttgggcatggtgccggaagtgcccacgtggctgtcgctggtggtcatcatcgtctgcatc
ggcggttcggcattagccagtgtcatcaagatgaagtcgatcgacgcgaagcaggccgcg
gcaccttcgaatcctcaggagcgcccctaa

DBGET integrated database retrieval system