KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_04930Help
Entry
BANAN_04930       CDS       T02047                                 

Definition
(GenBank) hypothetical protein
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PMM Hydrolase_3 PMBR Hydrolase
Motif
Other DBs
NCBI-ProteinID: AFI63194
Position
complement(1162476..1163282)
Genome map
AA seq 268 aa AA seqDB search
MAMANEVDIERLCATMKVMAFDLDGTLARSKKPMHKPMADAVSQLTRLLPVAIISGGTID
LVRSQVTDMLSEESDRSHMHLMPTSGTRYYRWNPEGADWQEVYEHNLSDEDRKLVIESLE
RHARELGIWQSHTWGPRIEDRGSQITFSALGQQAPVEAKEAWDPTNEKKNRLAEAVQKDV
PHLAVRSGGSTSVDISNRGVDKAYAVRKLAGMLGVTVGQIAFVGDRMDPDGNDYPAALAG
TIAIRVTGPEDTLQLCNRIIDWYNRNSR
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggccatggcgaacgaggtcgacatcgaacggctatgcgccacgatgaaggtgatggcc
ttcgacctcgacggcacgctcgcccgctcgaagaaaccgatgcacaagcccatggctgac
gcggtgtcgcagctgacacgcctgctgccggtggccatcatctccggaggcaccatcgac
ctcgtgcgctcgcaggtcaccgatatgctttccgaagaatccgaccgttcacatatgcac
ctcatgcccacatccggtacacgctactatcgttggaaccccgagggtgccgattggcag
gaggtgtacgagcacaacctgagtgacgaggaccgtaaactggtcattgaatcactggaa
cgccacgctcgtgagctcggcatttggcagtcgcatacctgggggcctcgcattgaagac
cgaggcagccagatcaccttctcggccctcgggcagcaggcccccgtggaagccaaggag
gcgtgggatcccactaatgagaagaagaaccggctcgccgaagccgtgcagaaagacgtg
ccccatctcgcagtgcgttcgggaggctccaccagcgtcgacatttcaaacaggggcgtc
gataaggcatacgccgtgcgcaagctcgccggcatgctcggtgtgacggtcggacagatc
gcctttgtcggagatcgcatggatcccgatggcaatgactatccggcggctttggccgga
acgatcgccattcgggtcaccggtccggaagacaccctgcagctttgcaaccgcatcatc
gactggtataacaggaattcacggtag

DBGET integrated database retrieval system