KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_04940Help
Entry
BANAN_04940       CDS       T02047                                 

Definition
(GenBank) hypothetical protein
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FixG_C
Motif
Other DBs
NCBI-ProteinID: AFI63196
Position
complement(1163809..1165353)
Genome map
AA seq 514 aa AA seqDB search
MSKHLESGSSKHSKVTKVAATTVSACVVAGALLVMAFIPGRQLSFGNANPANASVVQEVS
PKVMDQYCPAQMGLADTGTYGDKEFQASVGDLASGARYAAFGSIFHAQVSPLGDDSKSTV
LQGPQSDDADSTADSVVVASSDSAEAPQVFETRLLGASAGTGASGSMASWASNGDIAGVA
ASTCINMQLNQSFLISGTKEGTTQQLLIANPTDKSTTVQLSMTGTKPGQIVMATQSSVVV
GAGEQRTVDLAAAAPNQDALRVNLVSQESPVASVIRTVSMKGLDPDGNDFTLPLNPASTT
QIVNMGDSRNVMTLRAYASQAASLNLSWITQSGVKSAGKRAMKANVVNVMELNDIPDDAL
GLLIESDADFQAAAGIDVSDGGSRDFAFVNAASPYAQSALALPSGVQAHVSMVNASSKPI
ELSLTAYDEHGESVGTRDIHLDGDSAVMFSPTDISKNAVALSTDYEGNDVVWGAFLTSDK
VSSSDHSGLAYIGADRLEVAKQTVRAMHDATIVH
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagcaccttgagtccggttcatccaagcattcaaaggtgacgaaagtcgctgcc
accacggtttccgcatgcgtggtggctggcgcactactggtcatggccttcatccccgga
cggcagctgagtttcggcaacgccaatccggctaatgcctcggtggtgcaggaagtgagc
ccgaaggtcatggaccagtattgtccggcgcagatggggctggcggatacgggtacttac
ggagacaaggaattccaagctagcgtgggggatctggcttcgggtgcacggtatgcggcc
ttcggttcgattttccacgcacaggtttccccattgggcgacgattcgaaatccacggtg
ttgcagggaccacagtcggatgatgcggattccactgcggattcggtcgtggtggcgtca
tccgattccgccgaagccccgcaggtgttcgagacgagactgctgggagcgagtgcagga
acaggggcgagtggatccatggcctcttgggcgagcaatggcgatatcgccggtgtggcc
gcctctacatgcatcaacatgcaattgaaccagagcttcctcatttcagggacgaaggag
ggcaccacccagcaactgctcatcgcgaatcctacagacaagtcgacgactgtgcagctt
tccatgacggggacgaagcccgggcagattgtgatggccacgcaaagcagcgtcgtggtt
ggcgccggcgaacagaggaccgtggatctggcagccgcggcacctaatcaggatgctctc
cgagtgaatctggtatcgcaggagtcgccggtggcgtcggtgatacgaacggtctcgatg
aagggacttgatcctgatggcaatgatttcacgttgcccttgaatcctgcctccaccaca
cagattgtcaatatgggggattcccgcaatgtgatgacactacgagcatacgcgtcccaa
gcggcttccctcaacctgtcgtggatcacgcaatccggtgtcaaaagcgcagggaaacga
gccatgaaggcgaatgtggtgaacgtcatggaattgaatgacatccctgacgatgccttg
gggctgctcatcgaaagtgacgctgacttccaagctgcggccggcatcgacgtttccgat
ggcggatcccgtgatttcgccttcgtgaatgcggcaagtccctacgcgcaatccgccttg
gccctcccctccggggttcaggcgcatgtgagcatggtcaacgcctcatccaagccgatc
gagttgtcgctcacggcatacgatgagcatggcgagtcggttggaacccgcgatatccat
ttggacggcgattccgcggtgatgttcagcccgacggacatctcgaagaatgccgtcgca
ctctccacggattacgaggggaatgacgtggtgtggggtgcgttcctcaccagcgacaag
gtcagttcatcagaccatagtgggttggcctatatcggcgccgaccgactcgaggtggcc
aaacagacggtgcgtgccatgcacgatgccaccatcgtgcattag

DBGET integrated database retrieval system