KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_04950Help
Entry
BANAN_04950       CDS       T02047                                 

Definition
(GenBank) transcriptional regulator
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LytR_cpsA_psr DUF4012
Motif
Other DBs
NCBI-ProteinID: AFI63198
Position
1168638..1170092
Genome map
AA seq 484 aa AA seqDB search
MASHTDDSKRIVNIGGPVDEHPRHSTVQVRHVRYRILKIIAMVLVAVLVFAGSVAAATWL
NINNAVQSGKIRSLIEGGSDEDAYLDPNSGKPINFVLIGQDTRDGDGNGDVSGDGATEGG
LHNADTTMVVQIGADRNYVNLVSIPRDSLVDVPACHTSKETIPAQYGVQFNSIFANAYSV
GGDLSSAASCTVNAVNALTGLHISNFIVVDFNGLSKMIDSIDGVDLCFPSDVDDPNTNMH
LKKGMHHLNGVEATNYARRRHGNDTDGSDIMRTTRQQYLIKSVLQKAISRNLFTQTSQLY
QLVMNAIRSLNFSSGMADTNALMGLALSLRNLKVDRLYSQTVPIMSAPQDPNRVVWTEDA
KAVWAKFKEAKPLFGSDDSAGADKQEEQSQAPASEEPTEPAQTEDPSPQPSDDSGSPSQE
EKPRLDEKTGLLVHPDGTLTDPETGGVVDPDDGSIKDPNTNQYVGISYRYLNNTICKVPE
HSDD
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
ttggcttcacataccgacgacagcaagcgtatcgtgaacatcggcggtcctgttgacgag
catccgcggcacagcaccgtgcaggtcaggcacgtgcgataccggatcctcaagatcatc
gcgatggtgctggtcgctgtgctcgtgttcgcgggctctgtggccgcggccacctggctc
aacatcaacaatgcggtgcagagcggcaaaatcagaagtctcatcgagggcgggtcagac
gaagacgcctatctcgatcccaattcaggcaagccaatcaacttcgtgctcatcggccag
gacactcgcgatggcgacggcaacggtgatgtctccggagacggggccactgagggaggg
ctacacaacgccgacaccacaatggtggtgcagatcggggccgacagaaactatgtgaat
ctcgtctccattccgcgagactcccttgtcgacgtgccggcatgccatacctccaaggag
acgattccggcccaatatggcgtgcagttcaactcgatcttcgcgaatgcctattcggtg
ggaggtgacctctcctccgccgccagctgcacggtcaacgccgtgaatgcgctgaccgga
cttcatatcagcaacttcatcgtcgtcgatttcaacggtctgagcaagatgattgattca
atcgatggcgtcgacctgtgcttcccctccgacgtggacgacccgaacacgaacatgcat
ctgaagaagggcatgcaccatctcaatggcgtggaggcgaccaattatgcacgccgtcgc
cacggcaacgacaccgacggctccgacatcatgcgcacgacacgtcagcaatacctcatc
aaatccgtgttgcagaaggccatctcccggaacctgttcacgcagaccagccagctgtac
cagctggtcatgaatgcaatccgttcactcaacttcagctcgggcatggccgataccaat
gcattgatgggtctggccttgagtctgcgcaatctcaaggtcgaccgcctgtattcccag
actgttccgatcatgtcggcccctcaggaccccaaccgcgtggtttggaccgaggatgcc
aaggcggtgtgggccaagttcaaggaagccaagccgttattcggttcagatgactccgca
ggtgcagacaagcaggaggagcaatcccaagctcccgcttccgaggagccgacggagccc
gcgcagaccgaagacccctcaccacagccgtccgatgactcgggttcgccgagtcaggag
gaaaagcccaggcttgatgagaaaaccgggctgctagtgcatcccgatggcaccttgacc
gaccctgaaaccggtggcgtggtggacccggacgacggatcgatcaaggatccgaacacg
aaccaatacgtcggcatctcctatcgttacctcaacaacactatctgcaaagtgccggag
cacagcgacgactga

DBGET integrated database retrieval system