KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_04965Help
Entry
BANAN_04965       CDS       T02047                                 

Definition
(GenBank) hypothetical protein
  KO
K18955  WhiB family transcriptional regulator, redox-sensing transcriptional regulator
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
Brite
KEGG Orthology (KO) [BR:bni00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bni03000]
    BANAN_04965
Transcription factors [BR:bni03000]
 Prokaryotic Type
  Other transcription factors
   Others
    BANAN_04965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Whib
Motif
Other DBs
NCBI-ProteinID: AFI63201
Position
1173461..1173739
Genome map
AA seq 92 aa AA seqDB search
MSSAFDWRAKAACRDKDPELFFPVGNTGAAYQQIEEAKAVCRTCKVIDACLKCALDTNQD
YGVWGGLSEDERRALKRRAMRARRSQSLQMQI
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtgctttcgattggcgtgccaaagctgcatgccgtgataaggatccggagctt
ttcttccctgtaggcaacaccggcgcggcctaccagcagatcgaagaggctaaagcagtg
tgccgcacctgcaaggtgattgatgcctgcctcaaatgcgctcttgacacaaatcaggat
tacggcgtatggggcggtctgagtgaggacgaacgacgcgccttgaagcgacgcgccatg
cgcgcgcgtcgctcccagtcgctccagatgcagatttga

DBGET integrated database retrieval system