KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_04975Help
Entry
BANAN_04975       CDS       T02047                                 

Definition
(GenBank) hypothetical protein
  KO
K11068  hemolysin III
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
Brite
KEGG Orthology (KO) [BR:bni00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:bni02042]
    BANAN_04975
Bacterial toxins [BR:bni02042]
 Type II toxins: Membrane damaging toxins
  Pore-forming toxins, Other
   BANAN_04975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HlyIII
Motif
Other DBs
NCBI-ProteinID: AFI63203
Position
1175436..1176320
Genome map
AA seq 294 aa AA seqDB search
MTPEQVERKRAAVIEAREQALEAKANLVRTKAHAKAEKIRRKADNKAKRTIAKGEEKAAK
LEGIGPREIERKIRLDVHGREKPAMRGWIHAGAAPLAIAAGIVLICLAHGAALKWACAVF
MASSAFLFTNSALYHLGDWSPRVTDVLRRIDHVNIFLLIAGTYTPVSFALDDFWRKAIII
GMWSCTLIALIIHVVWINAPRWLYVLVYIIFGVSGVAFMGLFWMSPVAGPAVVWLLLAGG
ACYIAGAVVYAKRWPDPWPKVFGFHEIFHIGTVFGYACHVVAIYLVVCHLAALA
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgacaccggagcaagtcgaacgcaagcgcgcagccgtgatcgaggcccgtgaacaggca
ttggaggcaaaggcgaatctggtgcgtacgaaagcgcatgccaaggccgagaagattcgt
cgcaaggccgacaacaaggcgaagagaacgatagccaagggtgaggagaaggccgctaag
ctcgagggaatcggacctcgggaaatcgagcgcaagatccgcctcgatgtgcatgggcga
gagaagcccgccatgcgcggttggattcacgcaggcgccgccccgttggccatcgcggct
ggtattgtgctcatctgtctggcccatggggcagcactcaaatgggcttgcgccgtgttc
atggcatcctctgcattcctgttcacgaactccgcactataccatctcggcgactggtcg
cccagggtcaccgacgtgctgcgccgcatcgaccatgtcaacatcttcctgctcatcgcc
ggcacctatacgcctgtctccttcgccctcgacgatttctggcgcaaggcgatcatcatc
ggcatgtggtcctgcacactcatcgccctgatcattcatgtggtgtggatcaatgcaccg
cgttggctctatgtgctggtctacatcatcttcggcgtctccggcgtggcgttcatgggc
ttgttctggatgtcaccggtggccggccctgctgtggtatggctgctacttgccggcggc
gcatgctatatcgccggcgccgtcgtctatgccaaacggtggcccgacccatggccgaaa
gtgttcggcttccatgagatattccacatcggcaccgtgttcgggtatgcctgccatgtg
gtggccatctacttggtcgtatgtcatctggccgccctcgcctga

DBGET integrated database retrieval system