KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_04980Help
Entry
BANAN_04980       CDS       T02047                                 

Definition
(GenBank) transcription elongation factor GreA
  KO
K03624  transcription elongation factor GreA
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
Brite
KEGG Orthology (KO) [BR:bni00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:bni03021]
    BANAN_04980
Transcription machinery [BR:bni03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    Transcription elongation factors
     BANAN_04980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GreA_GreB_N GreA_GreB
Motif
Other DBs
NCBI-ProteinID: AFI63204
Position
complement(1176402..1176884)
Genome map
AA seq 160 aa AA seqDB search
MEQEEKVVLLTQEAYDKMKEELAHREGEYRDEITERIAAARAEGDLSENGGYQAAREEQS
KNEGRINELIVKLRNAKIIEAPKAGEVGNGSLVTIDLGGNEMQYVIGSRDITVATDYDVI
SPESPIGGAIIGHKVGDVVTYKAPNGREISVTIKESKPLN
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atggaacaggaagaaaaggtcgtgctgctcacgcaggaagcgtacgacaagatgaaggag
gagctcgctcatcgcgagggtgagtaccgcgacgagatcaccgaacgcatcgccgcggcc
cgcgcagagggcgacctctcggagaacggcggatatcaggccgcgcgcgaggaacagagc
aagaatgaggggcgcatcaacgaactcatcgtcaagctgcgcaatgccaagatcatagag
gcgcccaaggccggcgaggtgggcaatggttcgttggtcaccatcgatttgggtggcaat
gagatgcagtacgtgattggttcgcgtgacatcacggtggccaccgattacgatgtgatt
agccctgagtcgccgatcggcggtgcaatcatcggccacaaagtgggggatgtggtcacg
tacaaggcgccgaacggtcgtgagatctcggtcacgatcaaggaatccaagccattgaat
tga

DBGET integrated database retrieval system