KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_04985Help
Entry
BANAN_04985       CDS       T02047                                 

Definition
(GenBank) peptidyl-prolyl cis-trans isomerase
  KO
K01802  peptidylprolyl isomerase [EC:5.2.1.8]
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
Brite
KEGG Orthology (KO) [BR:bni00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BANAN_04985
Enzymes [BR:bni01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     BANAN_04985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FKBP_C
Motif
Other DBs
NCBI-ProteinID: AFI63205
Position
complement(1176970..1177377)
Genome map
AA seq 135 aa AA seqDB search
MATDMPVVKGAFGDTPQIEFPSEQAPQGLKVVELEEGNGPIVRRGDTVTVNYHGQVWGND
KAFDSSFERHHPASFGIGVGQVIKGWDQTVPGHNVGSRLLISIPPQYGYGANGAPQAGIG
GDDTLVFVVDIISTR
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atggcaacagatatgcctgtggtcaagggagcattcggcgatacgccgcaaatcgaattc
cctagtgagcaggccccgcaggggctcaaggtcgtggagctcgaagagggcaacgggccg
attgtacgtcgtggcgacacggtgaccgtgaactaccatggtcaggtgtggggcaacgac
aaggcgttcgattcaagcttcgaaaggcaccatccggcgagtttcggcattggcgtcgga
caggtaatcaagggttgggaccagaccgtgccggggcacaacgttggttcgcgtctgctc
atttcgattccgccgcaatacggctatggggccaacggtgcgcctcaggccggtatcggc
ggcgatgacacgcttgtgttcgtggtggacatcatctccacgcgctga

DBGET integrated database retrieval system