KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_05015Help
Entry
BANAN_05015       CDS       T02047                                 

Gene name
eno
Definition
(GenBank) phosphopyruvate hydratase
  KO
K01689  enolase [EC:4.2.1.11]
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
Pathway
bni00010  Glycolysis / Gluconeogenesis
bni00680  Methane metabolism
bni01100  Metabolic pathways
bni01110  Biosynthesis of secondary metabolites
bni01120  Microbial metabolism in diverse environments
bni01130  Biosynthesis of antibiotics
bni01200  Carbon metabolism
bni01230  Biosynthesis of amino acids
bni03018  RNA degradation
Module
bni_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bni00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BANAN_05015 (eno)
  09102 Energy metabolism
   00680 Methane metabolism
    BANAN_05015 (eno)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    BANAN_05015 (eno)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:bni03019]
    BANAN_05015 (eno)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bni04147]
    BANAN_05015 (eno)
Enzymes [BR:bni01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     BANAN_05015 (eno)
Messenger RNA biogenesis [BR:bni03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BANAN_05015 (eno)
Exosome [BR:bni04147]
 Exosomal proteins
  Proteins found in most exosomes
   BANAN_05015 (eno)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Enolase_C Enolase_N MR_MLE_C MAAL_C
Motif
Other DBs
NCBI-ProteinID: AFI63211
Position
complement(1182334..1183626)
Genome map
AA seq 430 aa AA seqDB search
MAAIESVYARQILDSRGNPTVEVVLDTDDGARGLGLVPSGASTGEAEAWERRDGDKSVYQ
GKGVLGAVKAVNEEIAPKVIGMDATDQRALDDLMIELDGTPNKGRLGANAILGVSLAALY
AAAESAELPLYRYIGGTNGHVLPVPNMNIMNGGAHADFATDIQEYMISPYGFQTYSEALQ
AGVEVYHTLKNVLKKQGLATGLGDEGGFAPKMKTNEDSLKYIMDAISAAGYEPGKQIGIA
LDVASSEFYNKETGKYHFDGEDRDSEYMLDFYEKLVDQFPIVSIEDPFQEEGWEDWAKIT
KALGDRLQFVGDDLFVTNPVRLKKGIDMGAGNSLLVKLNQIGTVSETLDAIELATKNGFT
SMVSHRSGETPDTTISDLAVAKNTGQIKTGAPARGERIAKYNRLLEIEEELGSTAEYAGY
SAFKACQKYM
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
gtggcagcaattgaaagcgtgtacgcacgccagattcttgattcccgcggcaacccgacc
gttgaggtcgtgctcgacaccgatgacggtgctcgcggcctgggtctcgttccctccggc
gcctccaccggcgaagccgaggcttgggagcgtcgcgatggcgacaagtccgtctatcag
ggcaagggcgtcctcggtgccgtcaaggcagtgaacgaggagatcgccccgaaggtcatc
ggcatggacgccaccgaccagcgcgcactcgatgacctgatgatcgagctcgacggcacc
ccgaacaagggccgtctgggcgccaacgccattctcggtgtctccctcgccgccctctac
gcggccgccgagagcgccgaactgccgctgtaccgctatatcggcggcaccaacggccat
gttctcccggttccgaacatgaacatcatgaacggcggcgcgcacgctgacttcgccacc
gacatccaggagtacatgatctccccgtacggcttccagacctactccgaggctctgcag
gccggcgtcgaggtgtaccacaccctcaagaacgtgctgaagaagcagggtctggccacc
ggtctcggcgatgagggcggcttcgctccgaagatgaagaccaacgaggattccctcaag
tacatcatggacgccatctccgccgccggttatgagccgggcaagcagatcggcatcgcc
cttgatgtcgcctcctccgagttctataacaaggagaccggcaagtaccacttcgatggt
gaggaccgcgattccgagtacatgctcgacttctacgagaagctcgtcgaccagttcccg
atcgtctccattgaggatccgttccaggaggaaggctgggaagactgggccaagatcacc
aaggccctcggcgaccgcctgcagttcgtcggcgacgatctgttcgtcaccaacccggtg
cgcctgaagaagggcatcgatatgggtgctggcaactccctgctggtcaagctcaaccag
atcggcaccgtttccgagaccctcgacgccatcgagctggccacgaagaacggcttcacc
tctatggtctcccatcgttctggcgagacgccggacaccacgatctccgatctcgccgtc
gccaagaacaccggccagatcaagaccggagccccggcacgtggcgagcgcatcgccaag
tacaaccgcctgctcgagattgaggaagagctcggttcgaccgccgaatacgctggctac
agcgcattcaaggcatgccagaagtacatgtga

DBGET integrated database retrieval system