KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_05025Help
Entry
BANAN_05025       CDS       T02047                                 

Definition
(GenBank) extracellular solute-binding protein
  KO
K15553  sulfonate transport system substrate-binding protein
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
Pathway
bni00920  Sulfur metabolism
bni02010  ABC transporters
Module
bni_M00436  Sulfonate transport system
Brite
KEGG Orthology (KO) [BR:bni00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    BANAN_05025
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BANAN_05025
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bni02000]
    BANAN_05025
Transporters [BR:bni02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Sulfonate transporter [MD:M00436]
    BANAN_05025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NMT1 Phosphonate-bd NMT1_2 SBP_bac_3 OpuAC NMT1_3
Motif
Other DBs
NCBI-ProteinID: AFI63213
Position
1184920..1185870
Genome map
AA seq 316 aa AA seqDB search
MLRFTPAACAALLALSCSACGEPNAADSSTTMRVAYLSTANYLTTVRGEDFLDETMQHTN
VKFTGPYNPTDAYSAVLSGNADATSTGTGSYINFVAQGQPWVAFAIEYYTGDSQGIVASP
KSGVNSLEDLYGRNVAIIKRGGTGDYVLHKAFEHAGLDVDRVNIVEMSPSNFQAAFTSGQ
IDALSSFDQNLAAAMATPSAKLLVNATEYGNKNVSIHLVSKDFATKHPEAVKAMYRALVR
ESDAAQATPSIITDAYREFGASDDVTEQIAKFNVPVIKPIDAEGLKMLESQAQEYVDFGF
IDAMPDLQAASMDCSA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgctcagattcacgcccgccgcatgcgcagcgttgcttgcactgtcatgctcggcctgc
ggcgaaccgaatgccgcggattcctctacgaccatgcgcgtggcctatctgtcgactgcg
aattacctgaccaccgtacgcggagaagactttcttgacgaaacgatgcagcacaccaac
gtcaaattcaccggcccatacaacccaacggatgcttactccgcagtgttgtcgggcaat
gccgatgccacgagtaccggcaccggctcgtacatcaacttcgtggcgcaaggtcaaccg
tgggtggccttcgcaatcgagtattacaccggtgattcgcaaggaatcgtggcctcgccg
aaatctggggtgaactcacttgaagacctctacggcaggaacgttgcgatcataaagcgc
ggcggcaccggcgattacgtgttgcacaaggcattcgagcatgccggactcgatgtagac
agggtgaacatcgtggagatgagcccctccaatttccaggcggctttcacttcgggacag
atcgacgcattgagttccttcgaccagaatctggccgccgcaatggcgaccccgagcgcg
aaactgctcgtgaatgcaacggaatacgggaataagaatgtctcgattcatctggtgtcg
aaggattttgccaccaaacaccccgaagcggtgaaagcgatgtatcgggcgctcgtcagg
gaatccgacgcggcgcaggccacgccgtcgatcatcaccgacgcataccgggaattcggc
gcatccgatgacgtgaccgaacagatcgcaaagttcaatgtgccggtgatcaagccgatt
gacgcagagggattgaagatgttggagtcccaggcgcaggagtatgtcgatttcggattc
attgacgcaatgccggacttgcaggcggcgtcgatggattgctcggcctga

DBGET integrated database retrieval system