KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_05050Help
Entry
BANAN_05050       CDS       T02047                                 

Definition
(GenBank) hypothetical protein
  KO
K09118  uncharacterized protein
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
Brite
KEGG Orthology (KO) [BR:bni00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BANAN_05050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPF0182
Motif
Other DBs
NCBI-ProteinID: AFI63218
Position
complement(1191790..1194960)
Genome map
AA seq 1056 aa AA seqDB search
MSFFDPFFGAGHGTRRSQSQSNDDDPIVINIETDGEPPHSNAAGAGNGTPRSPRITRKPA
KPHGNHGRRVAIAVVVAIAIIVALFFAISSFAADVMWYSQLGFQSIVWTLLGARVGLWVF
YAALMVLVSYIAATLAIRARPDFADGSTIRINGDTIEIGKSVSSRTARRVAVVISLIAGI
IFGSKVNANWTEILLMFHTQSFGSVDPQFGLDNGFYVFVLPGLRMLVSAFTLLMFVALVF
SVATHVAMGGIRFTMPVHGHGLFAITKRARRQIGIWLVLWMLSWAVSQGLSVFSSLTAQG
DRFTGANYTAVTAGIPVTIIMAVLTAVLGVVLCVWLMTTHVFDDAVSRPTANASAAWREW
RVPTIAVASTLVVGILLSTLWPMLLQRFRVNPNAQEMESAYIQRNIDATRAAYGLDAVKT
EEYKATTKAQAGALQKDAETTAQIRLLDPQIVSPTFKQLQQMKQYYTFADTLAVDKYDID
GVNQDTVIAAREINLEGNDNRNWVNDHTVYTHGYGIVAAYGNKVTSDGQPQFFEYGIPTQ
GYLTDTQHYEPRIYFSPEAPEYSIVGAPQGTQSWEFDYPTGSEGATTTFNGNGGPRIGNI
FSRLIYSIKFGSDQILFSDRVNADSQILYDRSPKERVAKVAPYLTLDGRVYPAVVDGRVK
WIVDGYTTSSNYPYSQKTDLAEATQDSTTISSQTVQGLTDKEVNYMRNSVKATVDAYDGS
VDLYTWDDSDPVLKAWQSIFPGQYHPMSEISGDLMAHMRYPEGMFKVQRQLLAKYHVTSA
SQFFSGEDFWQTPVDPTESKSEQSRDVLQPPYYLTLQTGGSDEPVFSLTSTYIPAGSSTR
EILTGFLSVDSDAGRTKGVRGPDYGTIRLQELPKDSNVPGPGQAQNNFNANADVSKELNL
LESGSTQVERGNLLTLPLGGGLVYVEPVYVKSSGATSYPLLKKVLVAFGDQVGFANTLNE
ALNQVFDGNSGAQAGDGENQGSSGNPSDSGAADDKADGSGSTANTNRNPELSQALQDAGK
AMKDADSAMKKGDWSGYGEAQKRLEEALDKAMALDK
NT seq 3171 nt NT seq  +upstreamnt  +downstreamnt
atgtctttctttgacccattcttcggtgccgggcatggcacccggcgatcacaatcgcaa
tcgaatgatgacgatccgatcgtcatcaacatcgagaccgacggcgagcccccgcattcg
aatgctgcaggcgccggcaacggcacgccccgctctccgcgcatcactcgcaagcctgcg
aaaccccatggcaaccacgggcgccgggtggccattgccgtcgtcgtggccattgccatc
atagtggcgttgttcttcgcgatctcgtcattcgcagcagacgtcatgtggtattcgcag
ctcggcttccagagcattgtctggacgttgctcggcgcccgtgtgggcttgtgggtgttc
tatgcagccctcatggtgctcgtcagttacattgccgctactctggccattcgtgcacgc
cccgatttcgccgatggctccacaatccgcatcaacggcgacaccatcgagatcggcaag
agcgtgagctcgcgcactgctcgccgcgtggcggtggtcatctcgctgatcgcgggcatt
attttcggttccaaggtcaatgcgaactggaccgagatcctgctcatgttccacacccag
agcttcggctccgtcgatcctcagttcggcttggacaacggtttctacgtattcgtgctg
ccgggactgcgcatgctcgtctccgcgttcacactgctcatgttcgtggcgctggtgttc
agcgtggccacgcatgtcgccatgggcggcattcgcttcacgatgccggtgcatggccac
ggtttgttcgccatcacgaagcgtgcccgtcgccagatcggcatctggctggtgctgtgg
atgctgtcctgggcagtgagccaagggctctcggtcttttcatcgctcaccgcacagggc
gatcgattcaccggcgccaactacaccgcggtgactgccggcattcccgtcaccatcatc
atggcggtgctcacagccgtcctcggcgtggtgctgtgtgtgtggctcatgaccacccat
gtattcgacgacgccgtatcgcgtcccacggcgaatgcatccgccgcatggcgtgaatgg
cgcgtgcccaccatcgccgtggcgtccacgctcgtcgttggcatactgctgtccacgcta
tggccgatgctgctccagcggttccgcgtgaatccgaatgcacaggagatggaatcggca
tacattcagcgcaacatcgacgcgacccgggctgcctacgggctggatgcggtgaagacc
gaggagtacaaggccaccacgaaggcgcaggccggcgccctgcagaaggacgcggagacc
acggcgcagattcgactgctcgacccgcagatcgtctcgcctacattcaagcagcttcag
cagatgaagcagtactatacgttcgccgacacgctggcggtcgacaaatatgacatcgat
ggcgtcaatcaggacacggtgatcgcagcccgagagatcaacctcgagggcaacgacaac
cgcaattgggtgaacgaccacaccgtgtacacccatggctatggcatcgtcgccgcctac
ggcaacaaagtgacgagtgacgggcagccgcagttcttcgaatacggcattccgacgcag
gggtatctcaccgacacccagcactacgaaccgcgcatctacttctcgccggaagcaccc
gagtattcgatcgtcggcgcgccacagggcacgcagtcgtgggaattcgactacccaacg
ggttccgagggagccaccaccaccttcaatggcaatggtggcccgcgcatcggcaacatc
ttctcccggctcatctattcgatcaagttcggctccgaccagatcctgttctccgaccgt
gtgaacgcggattcccagattctctacgatcgttcccccaaggaacgtgtcgccaaggtc
gcgccgtacctcacccttgacggacgagtgtatccggcggtggtggacggccgggtcaaa
tggattgtggatggctacaccacctcgagcaactacccgtactcgcagaagacggacctt
gccgaggcgacgcaggactccaccaccatctcctcccagacggtgcagggcctgacggac
aaggaagtcaactacatgcgcaattcggtgaaggccaccgtcgacgcctacgacggttcg
gtggacctctacacctgggatgactccgatccggtgctcaaggcgtggcagagcatcttc
ccgggccaataccacccgatgagcgagatctccggcgacctcatggcgcatatgcgctat
ccggagggcatgttcaaggtgcagcgccagctgctggccaaataccatgtgacctcggcc
tcgcagttcttctcgggcgaggacttctggcagaccccggtcgatccgaccgaatcgaag
agcgagcagtcccgcgatgtgctgcagccgccgtattacctcactttgcagaccggcggt
tccgacgaaccggtgttctcgctcacctccacatatattccggcgggttcgagcacccgt
gagattctcaccgggttcctgtcggtggactcggacgccggccgcaccaagggcgtcaga
ggacccgattacggcacgatacgcctgcaggagctgccgaaggattccaatgtgcccgga
cctgggcaggcgcagaacaacttcaacgcgaacgccgatgtgtcgaaggagctcaacctg
ctcgaatccggttcgactcaagtggaacgcggcaatctgctcacgttgccgctgggcggt
ggcctggtctatgtggagccggtgtacgtgaagtcctccggcgcgaccagctacccgttg
ctcaagaaagtgctcgtcgcctttggagaccaggtcggtttcgccaatacgctcaacgag
gcgttgaaccaggtgttcgatggcaattcgggcgctcaggccggcgatggcgagaatcag
gggagtagcgggaatccgtccgattccggtgcggccgacgacaaggcggacggttcgggc
tccacagcgaatacaaaccggaatcctgagctttcgcaggctctgcaggatgccggaaag
gccatgaaagacgccgactccgcaatgaagaagggcgactggagcggctatggggaggcg
cagaagcgtctcgaagaggcactcgacaaggcgatggcactcgacaagtga

DBGET integrated database retrieval system