KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_05090Help
Entry
BANAN_05090       CDS       T02047                                 

Gene name
aspA
Definition
(GenBank) aspartate ammonia-lyase
  KO
K01744  aspartate ammonia-lyase [EC:4.3.1.1]
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
Pathway
bni00250  Alanine, aspartate and glutamate metabolism
bni01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bni00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BANAN_05090 (aspA)
Enzymes [BR:bni01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.1  aspartate ammonia-lyase
     BANAN_05090 (aspA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyase_1 FumaraseC_C
Motif
Other DBs
NCBI-ProteinID: AFI63226
Position
1202184..1203653
Genome map
AA seq 489 aa AA seqDB search
MDSTRQAAETRLEHDVIGTMEIPADVYWGIHTQRAMGNFTVTGIADGSHTALIRAYATVK
RACAIANYQLGMLDARKAHYIEQACLEIENGALADQFPVDVLQGGAGTSLNMNMNEVIAN
RALELAGKPRGDYGYIHPNDDVNQSQSTNDTYPAACRLAILQGLKPLREATQRLREAFHL
QADRHSNDIKIGRTQLQDAVPMTYGQEIHAWASFLATDLEAMNTLAKRLCVFNLGATAIG
TGICADLRFRHTATAVLAEITDLPITAASDPVAAVTDTSSYIEASAVLKNLAVHLKKAAD
DLRLLNSGPHCGFGDLTVPPRQAGSSIMPGKINPVIPECVDQCCFTIFGMDVTVNWACAE
GQLQLNAFDPLIIHEILTAMTIAINAMDMFRTKCVDGLRINVEQGRRDAEMSPSICAALN
GKIGYEQAMNIAKEAVATGKSVREVAGERTDIDRTELDSLLDIAAMSRKLGQTCRDVDAD
GNVISPTTD
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggattcgaccagacaggctgcagaaacgcggctggaacacgacgtcataggcacaatg
gagattcctgccgacgtgtactggggcatccacacccagcgagccatgggcaacttcacc
gtcaccggcatcgccgacggctcccatactgcgctcatccgagcctacgccaccgtcaaa
cgcgcctgcgccatagcgaactaccaattgggcatgctcgacgctcgcaaggcccattac
atcgagcaggcctgtctggagatcgagaacggcgcgcttgccgaccagtttcccgttgac
gtgctgcagggcggagcgggcaccagcctgaacatgaacatgaacgaggtgatcgccaac
cgcgcgcttgagctggccggaaagccccgtggcgactacgggtacattcatcccaacgac
gatgtgaaccaaagccaatccaccaacgacacctatcctgcggcctgcaggctcgccatc
ctccaaggtctcaaacctctgcgcgaggccacgcagcggcttcgtgaggcattccacctg
caggcagaccgccatagcaacgatataaagatcggtcgcacacaactgcaggatgcggtg
cccatgacctacggtcaggagatacacgcttgggcgagcttcctggcgaccgatttggag
gccatgaatacgttggcgaaacggctgtgcgtattcaatctgggggccacggcaattggc
actggcatctgtgccgatcttcgcttccgccacaccgccaccgccgtgctcgccgaaatc
accgacctgcccatcaccgccgcctcggatcccgtggccgccgtcaccgacaccagctcc
tacatcgaagccagtgccgtgctcaagaatcttgcggtgcacctgaagaaggcggccgac
gacctccgcctgctcaattccggcccacattgcggcttcggagatctcacggttcccccg
cggcaggcaggctcctcgatcatgcccggcaagatcaatccggtgattcccgagtgcgtg
gaccaatgctgcttcacgatcttcggcatggatgtgaccgtcaactgggcatgcgcggaa
ggccagctccaactcaacgccttcgacccgctcatcattcacgagatactcaccgcgatg
acaatcgccatcaacgccatggacatgttccgcacgaaatgcgtcgacggactgagaatc
aacgtcgagcagggacggagagacgcggagatgtcgccatcgatctgtgccgcgctgaat
gggaagatcgggtatgagcaggcgatgaacatagccaaggaagccgtcgccaccggcaaa
tcggtgcgcgaagtggccggggaacgcaccgacatcgatcgcaccgaactcgattcactg
ctcgacatcgccgccatgtcgcgaaaactcggacagacctgccgtgacgtggatgccgac
ggcaacgtcatctcaccgacaacggactga

DBGET integrated database retrieval system