KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_05100Help
Entry
BANAN_05100       CDS       T02047                                 

Definition
(GenBank) ferrous iron transport protein B
  KO
K04759  ferrous iron transport protein B
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
Brite
KEGG Orthology (KO) [BR:bni00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bni02000]
    BANAN_05100
Transporters [BR:bni02000]
 Other Transporters
  Others
   BANAN_05100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FeoB_N Gate MMR_HSR1 FeoB_C AIG1 RsgA_GTPase SRPRB Dynamin_N Roc ATP_bind_1
Motif
Other DBs
NCBI-ProteinID: AFI63228
Position
1204127..1206178
Genome map
AA seq 683 aa AA seqDB search
MSNESHSQHSRGFAAILPRKHDGNGSRHTKPCCDTGGHRISANDSHRRIVFIGNPNVGKS
SLFNAILGTKSRVMNAPGTTVLLEEGEYTHDGDTWDLIDTPGTYSLLPLSPDEKVAADAV
MGLDGEKDPDLIVTVLDATNISRSLYFLAMVLELGKPTVVALTMNDLARKQGAGIDPKEL
SHTLGGVPVVEVNGRSGEGKRELMDMVGTHFSGTALPAGLTAVDPHTVDVPQWVEGNADA
RFDWAAQVLSQLNMQARDRVTVSDRIDRVLLNPFLGVIVFLALMYAMFQATTVLAGPAQD
WVDGTVREWLTAGVDWVFNLFGPHAVYGWFHSLVVDGLIDGIVTIGTFIPPMGIMFICLS
LLEDSGYLTRAAFVMDRAMRCMHLDGRAFLPIVIGFGCNLPALAATRTLPDSRQRVMVGM
LVPFSSCTARLSVYMVLAYAFFREQAGLVVFLMYVISIVLILLVGILLRKVKFTSLTSEP
FAMSLPPYQWPRLVVLIRSVLMRLWGFVRGASSIIITMLIAMWLLQSIPATATAGSFAAV
DDVHDSVYGVVADTVAPVFKPAGFDDWHASAALMTGFVAKEVVVASMAQSYSINTGDEDE
QQQGEGSLGARLRSSFDESSGGHGKAAAIAFLVFTLAYTPCLATVAEMRRQFNMKIAMQS
VGMSLIIAYVLAVLAFQLLRFIW
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacgaatcacattcccagcactcacgcggcttcgccgccatactgccccgcaaa
cacgacgggaatggcagccgccataccaagccatgctgcgacaccggcggtcaccgcatc
tcagcgaatgactcgcaccgacgcatcgtgttcatcggcaatccgaacgtcggcaaatcc
tcgctgttcaacgcgattctcggcacaaaaagccgtgtgatgaacgccccgggcactacg
gtgctgcttgaggaaggcgaatacacgcatgatggcgacacctgggatctcatcgacaca
ccgggcacctattcccttcttccgctctcccccgatgagaaagtggcggccgacgccgtg
atgggtctggatggggagaaggatcccgacctcattgtcaccgtgctcgacgccacgaac
atctcgcgctcgctgtatttccttgccatggttctcgaactcggcaaacccaccgtggtc
gcattgaccatgaacgacctcgcacgcaaacagggagcgggcatagacccgaaggagctc
tcgcacacactgggaggcgtcccggtggttgaggtgaacggccgttccggcgaaggcaag
cgtgagctcatggatatggtcggcacccacttctccggtacagcgctgccggcgggactc
accgccgtcgaccctcatactgtcgacgtgccgcaatgggtggagggcaatgccgacgca
cgattcgactgggccgcacaggtgctttcacagctcaatatgcaggcacgagaccgcgtg
acggtctccgaccgcatcgatcgcgtgctgctcaacccgttcctgggcgtcatcgtgttc
ctcgccctcatgtatgcgatgttccaggccaccacggtattggccggccctgcccaggat
tgggtggacggcaccgtgcgcgaatggctcaccgcaggcgtggactgggtcttcaatcta
ttcgggccgcatgccgtatatggctggttccactcactcgtcgtcgacgggcttatcgac
ggcatcgtcacgatcggcacattcattccaccaatgggcatcatgttcatctgcctgtcg
ttgctcgaagactccggatacctcacccgcgcggccttcgtgatggacagggcgatgcgc
tgcatgcatctcgacgggcgcgccttcctgccgatcgtcatcgggttcggatgcaatctg
ccggcgctcgccgcgacccgcacgctgcccgattcgcgccaacgcgtgatggtgggcatg
cttgtgccgttctcaagctgcaccgcgagactgtcggtgtatatggtgctcgcctatgca
ttcttccgcgagcaggcgggtcttgtggtgttcctcatgtatgtgatctccatcgtgctc
attctgctggtgggcatcctgctgcgcaaggtgaagttcacaagcctgacctccgagcct
ttcgcaatgagtctgccgccataccagtggccgcgtctcgtcgtgctcattcgctcggtg
ctcatgcgcctgtggggattcgtacgtggcgcgagctcgatcatcatcaccatgctcatc
gccatgtggctgctgcagagcattccggcgaccgcgacggccggctcgttcgctgcggtg
gatgatgtgcatgattcggtgtatggcgttgtggccgacaccgtggcccctgtgttcaag
cccgcgggtttcgacgactggcatgcatcggccgccttgatgaccggcttcgtggccaag
gaggtcgttgtcgcgtccatggcgcaatcgtacagcatcaacaccggcgatgaggacgag
cagcagcagggcgaaggctcgcttggcgcccgtctgcgctcgtcgttcgatgaatcgtcc
ggagggcacggcaaggccgcggccattgcgttcctggtgttcacgctcgcgtacacacca
tgtctggccacggtggcggagatgagacggcagttcaatatgaagatagcgatgcaatcc
gtgggcatgagtctgatcatcgcctatgtgctcgccgtgctcgcgttccagttgctgagg
ttcatctggtga

DBGET integrated database retrieval system