KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_05110Help
Entry
BANAN_05110       CDS       T02047                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
Pathway
bni00030  Pentose phosphate pathway
bni00480  Glutathione metabolism
bni01100  Metabolic pathways
bni01110  Biosynthesis of secondary metabolites
bni01120  Microbial metabolism in diverse environments
bni01130  Biosynthesis of antibiotics
bni01200  Carbon metabolism
Module
bni_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bni_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:bni00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BANAN_05110
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BANAN_05110
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bni04147]
    BANAN_05110
Enzymes [BR:bni01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     BANAN_05110
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     BANAN_05110
Exosome [BR:bni04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   BANAN_05110
  Exosomal proteins of colorectal cancer cells
   BANAN_05110
  Exosomal proteins of bladder cancer cells
   BANAN_05110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AFI63230
Position
1206683..1208242
Genome map
AA seq 519 aa AA seqDB search
MTEHTTHIPGDSPWVNPLRDPRDLRLPRIAGPCSIVIFGVTGDLARKKLLPAIYDLANRG
LLPPSFGLTGFARRDWTEDHFRQFVKENVQQHCRTHFNEVTWNQLAEGIRFVHGTFEDAD
AFERLSNTVAELDKDRGTRGNHAFYMSIPPRDFPLVAQQLANCGLAKSNGDAWRRVIIEK
PFGHDLASAKELDRVISEVFDPNSVFRIDHYLGKETVQNLLALRFANSMYEPIWNSNYVD
HVQITMAEDIGVEGRAGYYDGIGAARDVIQNHLLQLLALTAMEEPVSFNARDLTDEKTKI
LSAVRLPKDLAAHTARGQYSAGWQGSRPVVGYLEEKGINPDSTTETYAAVRLDIDTRRWA
GVPFYLRTGKRLGRRVTEIALVFKRAPHLPFDSTATQELGKNAIVIRIQPYEGVTIRFGS
KVPGGTTMEVRDVSMDFSYGRSFTESSPEAYERLILDVLLGDPPLFPTTQEVDLSWKILD
PIEDFWSTLGQPQPYRAGTWGPQEAVEMLARDGHRWRMP
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacacacaacgcacattcccggggactcgccctgggtcaatccgttgcgcgac
ccacgggatctgaggcttccccgcatcgccgggccatgttcgatcgtgatcttcggtgtc
acgggcgatctggctcgcaagaaactgttgccggcgatctacgatctcgcaaaccggggc
ctgctgccgccaagcttcggtctcaccggtttcgcacggcgtgattggacggaggatcat
ttccgtcaattcgtcaaggaaaatgtgcagcagcattgccgcacgcatttcaacgaggtc
acctggaaccagcttgcagagggcatacgtttcgtgcatggcaccttcgaggatgccgat
gcgttcgagcgcctgagcaacacggtggccgaactcgacaaggaccgtggcacacgcggc
aaccatgccttctacatgtcgattccgccccgtgacttcccgctcgtggcgcagcagctc
gccaactgcggtctggccaaatcgaacggcgatgcctggagacgcgtgatcatcgaaaag
ccgttcgggcacgatctggccagcgccaaggagctcgaccgcgtgatctccgaggtgttc
gacccgaactcggtgttccgcatcgaccactacctgggcaaggagaccgtgcagaatctg
ctggcgttgcgcttcgccaactccatgtacgagccgatatggaattcgaactatgtggac
cacgtgcagatcacgatggccgaagacattggcgtggaggggcgagccggttactacgac
ggcattggtgcggcacgcgatgtgatccagaaccatctgctgcagttgctcgcgttgacg
gccatggaggaaccggtttcgttcaacgcgcgtgatctgaccgatgagaagacaaagatt
ctctcggccgtgcgcctgccgaaagaccttgccgcgcataccgctcgcgggcagtattca
gccggctggcagggttcccgtccggttgtgggatatctggaggagaaaggaatcaacccg
gattccaccactgaaacctatgcggccgtcagactcgatatcgacacgcgtcgctgggct
ggcgtcccgttctacctgcgtaccggcaagcgccttggccgtcgcgtgaccgaaattgcg
ctggtgttcaagcgcgccccgcatctgccctttgacagcaccgccacacaggagctcggc
aagaacgccatcgtcattcgcatccagccctatgagggcgtcaccattcgtttcggctcc
aaggttccgggaggcaccaccatggaagtgcgtgacgtctcgatggacttcagctacggc
cgctcgttcaccgaatcgtcacccgaggcttacgagcgcctcatcctcgacgtgctgctg
ggagatccgccgttgttcccgaccacgcaggaagtggacctgtcgtggaagatcctcgac
cccatcgaggatttctggtccacgctcggccaaccacagccctatcgtgccggcacatgg
ggcccccaggaggcggtggagatgcttgcccgtgatggacaccgttggaggatgccatga

DBGET integrated database retrieval system