KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_05115Help
Entry
BANAN_05115       CDS       T02047                                 

Definition
(GenBank) hypothetical protein
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OpcA_G6PD_assem
Motif
Other DBs
NCBI-ProteinID: AFI63231
Position
1208239..1209189
Genome map
AA seq 316 aa AA seqDB search
MILTLTDTQTDEISAKIDELHEERGEAALGRVLTLVVATDEKNLESSLCIANEASRDHPC
RVIAICPSHREMTEPESERTYLDAELRVGADAGAGEIIILRPRGGLTHHLDTLVIPLLLP
DTPMVVWWPTEAPANPSHDLLGQMAHTRITDAYRSSNPQRTIEDLRRNWSSKNVDLSWTR
LTLWRAVLASMVDQPPHLPIQSVRITGEQDYLPMDLLAAWLTLRLNVPVTIEIEPNAQAI
TGVYLTRKDGELSLERRPSEEGIARISVPGQSPQAMPLPIRSMVDCMSEELGRLYPDEIY
AEVLTKGWQKIHPSIR
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgatcctgacattgaccgatacccagaccgatgagatctcggcaaagatcgacgagctc
cacgaggagcgcggcgaggccgcacttggccgtgtgctcacgcttgtggtcgcaaccgac
gagaagaacctcgagagttcgctgtgcattgccaacgaggcaagccgcgatcacccatgc
cgtgtcatcgccatctgcccaagtcatagggagatgaccgaacccgagtccgaacgcacc
tatctcgatgcggaactgcgtgtgggtgcggatgccggcgccggcgaaatcatcattctg
cgcccgcgcggcggcctcacccatcacctcgacacgttagtgattccgttgctgctgcct
gacaccccgatggtggtgtggtggccgaccgaagcgccggcgaacccgtcgcacgaccta
ctcgggcagatggcgcacacgcgtatcaccgacgcataccgctcatcgaacccgcaacgc
accattgaggatctacgccgcaactggtcatcgaagaacgtcgacctgtcatggacacgg
ctgacgctgtggcgtgccgtgctcgcctcaatggtggatcagccgccgcatctgccgatc
cagtcggtgcgcatcaccggcgagcaggactacctgcccatggatctgttggccgcatgg
ctgaccctgcgactcaatgtgccggtcaccatcgagatcgagccgaatgcgcaggcgatc
accggcgtctacctcacccgcaaggacggcgagctgagtctggaacggcgtccaagtgaa
gagggcattgcgcgcattagcgtacccggccagtcaccacaggccatgccgctgccgatc
cgttcgatggtcgattgcatgagcgaggaactcggcagactctaccccgatgaaatctat
gccgaagtgctcaccaaaggctggcagaagattcacccgagcatccgctaa

DBGET integrated database retrieval system