KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_05130Help
Entry
BANAN_05130       CDS       T02047                                 

Definition
(GenBank) hypothetical protein
  KO
K05995  dipeptidase E [EC:3.4.13.21]
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
Brite
KEGG Orthology (KO) [BR:bni00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bni01002]
    BANAN_05130
Enzymes [BR:bni01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.13  Dipeptidases
    3.4.13.21  dipeptidase E
     BANAN_05130
Peptidases [BR:bni01002]
 Serine Peptidases
  Family S51
   BANAN_05130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S51 GATase_3
Motif
Other DBs
NCBI-ProteinID: AFI63234
Position
complement(1211659..1212366)
Genome map
AA seq 235 aa AA seqDB search
MNVNTHVCGPTLVLASSNTGLMPVLRRELGPLRGVRMAFIPTASTVEPYGVLVRLMRIRF
VLAGLRVQMVDPERMAAAQVCARLQSSDIIYVGGGNTFHLMHHLHASGADDVIRKLVREG
VPYVGESAGAVVASDDISYIAPMDENRGHTHMRGLALTRFHVIPHVGSVSMGSSARRIVA
MHAGQQDYVPLFNGQALVVRGHVARIAAMPLVEQFRRLRNACHECMHSAGKMHVH
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtgaacacgcacgtatgcggtcccacgctggttctggcctcgtcgaacacaggg
ctcatgcctgtgctgagacgtgagctcggtccgttgcgtggcgtccgcatggcgttcata
ccgacggcgagcacggtggagccgtatggggtgcttgtcaggctcatgcgcatacggttc
gtgctcgctggattacgagtgcagatggtggatcccgaacgtatggccgccgctcaagta
tgtgcgcgattgcagtccagcgacatcatctatgtgggtggcggcaacacattccatttg
atgcaccatctgcatgcgtccggtgcggatgacgtcattcgcaagctggtgcgcgaaggg
gtgccgtatgtgggggagtcggctggggcggtggtggcgtctgacgacatctcgtacatt
gcaccgatggatgagaacagggggcatacgcatatgcgggggctcgccctcacgcgcttc
catgtcattccgcacgtcggctcggtgtcgatgggctccagcgcacgtcggattgtcgcc
atgcatgccgggcagcaggactatgtcccgctattcaatggtcaggcattggtcgttcga
ggtcatgtggctcgaattgccgcgatgcctttggtcgagcaatttcgccgactacgcaat
gcatgccatgaatgcatgcacagtgcagggaagatgcatgtgcattag

DBGET integrated database retrieval system