KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_05155Help
Entry
BANAN_05155       CDS       T02047                                 

Definition
(GenBank) ATP-dependent RNA helicase
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DEAD Helicase_C ResIII SprA-related
Motif
Other DBs
NCBI-ProteinID: AFI63239
Position
complement(1218953..1220893)
Genome map
AA seq 646 aa AA seqDB search
MNDADSIYEEPARSFGELGVPGPLVRLLAADGKKTAFPIQQDTLPDSLAGRDVLGRGQTG
SGKTLAFGLPLVSRLSDMDRADDHDFPRDMDPQALRKSLRFKRGVSKYMPHPRGLVLAPT
RELANQISDVLTPLADAYGMAVTTVYGGVKYERQFRDLDDGADIVVACPGRLEDLIEQQA
LTLADVRIVVLDEADEMADMGFLPPIKRILKQIRPDAQHMLFSATLDHGVDEVVSEFLHD
PKVHSVDEVTSNVDSMTHHLFLVSRNDKAAVVRELASGRGRRILFTRTKFQAKKLAHTLT
QSGIPAAELHGNLSQHQRDRNLQAFESGQVNVLVATDVAARGIDVSNVGLVVQVEPPEDP
KSFTHRSGRTARAGQSGDVVTLMTPDQKRKIRHLFKEVDIKLKPVEVTPESPQVQELVGQ
KADPVHGWELPELERKPRKSNGGRKSRRDRGRTNRDEERGSRSARGGRRTGKGEHRPTER
ERQIAKEQQEFAALFLGDVSSDNPRYSEPAESEQASRHERDRRRDERPRNRRERRAEQFG
EAGDDRDYKKSRQNRNNGKKRIERRHARREEEREERRGGKRIHHHDNDRLFDARDESVKR
HERRLEAREQTRTAPKRARKSGKYSQFKNKGKRRNDNPFRGGRGRR
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatgcggactccatatatgaggagcctgcgcgctcgttcggtgaactcggcgtg
cccgggccgcttgttcgcctgctggctgccgacggcaagaagaccgcgttccccatccag
caggacacgcttccagactcacttgccgggcgtgatgtgctcggccgagggcagaccggt
tccggcaagaccttggccttcggactgccgctcgtctccaggctttccgatatggatcgt
gccgacgaccatgatttcccccgtgacatggatccgcaggcattgcgtaaatcgctgcgg
ttcaagcgcggcgtctcgaagtacatgccgcatccgcgcggtctggtgctggcgccgacc
cgtgagctcgccaatcagatcagtgacgtgctcacccccctcgcagatgcttacggcatg
gccgtcaccacggtatacggcggtgtcaagtacgagcgacagttccgggacctcgacgat
ggcgccgacatcgtcgtcgcttgcccggggcgcctggaagatctgattgaacagcaggcg
ctgacgctcgccgatgtgcgcatcgtggtgctcgacgaggccgacgagatggccgacatg
ggcttcctgccgccgatcaaacgcattctcaagcagattcgccccgacgcgcagcatatg
ctgttctcggccacgctcgaccatggtgtcgacgaggtggtcagcgaattcctgcacgat
ccgaaggtgcatagtgtcgatgaggtgacgtcgaatgtcgattcgatgacccaccatctg
ttcctcgtatcccgcaacgacaaggcggccgtcgtgagggagctcgccagtggacgcggc
cgccgcatcctgttcacgcgtacgaagtttcaggccaagaagctcgcccacacgctgacg
cagagcgggatcccggcagccgaactccatgggaacctgagccagcaccagcgcgatcgg
aacctgcaggctttcgaatccggtcaggtgaatgtgctcgtggccaccgatgtggcggcc
cgcggcatcgatgtgagcaacgtgggtctggtggtgcaggtcgaaccgccggaggatccc
aagtcgttcacccatcgctccggcagaaccgcccgtgccggccagtccggcgatgtggtc
acactcatgacgccggatcagaagcgcaagattcgtcacctgttcaaagaggtcgacatc
aagctcaaaccagtcgaagtcacccccgagtccccacaggtgcaggaactcgtagggcag
aaagccgatccggtgcatggctgggagcttcccgagcttgaacgcaaaccgcgtaaaagc
aatggcggccgcaagtcgcgtcgtgaccggggtcgcacgaaccgtgatgaggaacggggc
agccgctcggctcgtggtggacgccgtaccggcaagggcgagcatcggcccaccgaacgc
gaacgccagattgccaaggagcagcaggaattcgccgcattgttcctcggcgatgtgagt
tcggacaacccacgttactccgagcctgcggagtcagaacaggcgagccgccatgagcgc
gatcgccggcgcgacgaacggccgcgcaaccggcgggaacgtcgcgccgagcagttcggc
gaggccggtgacgaccgtgattacaagaaatcacgccagaaccgcaacaacggcaagaaa
cgcatcgaacggcgccatgcccgtcgcgaggaggagcgtgaagagcgtcggggtggcaaa
cgcatccaccaccacgacaacgaccgtctgttcgatgcccgcgatgaatcagtcaagcgc
catgaacgcaggctcgaggcccgcgaacagacccgaaccgcccccaagcgtgcccggaag
tcaggcaagtacagccagttcaagaacaagggcaagcgccgcaacgataatccgttccgc
gggggccgtggtcgtcgctga

DBGET integrated database retrieval system